Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4VCC9

Protein Details
Accession C4VCC9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
136-162GHAVSHDKQKSSKKKNKKIKNIYLKKIHydrophilic
NLS Segment(s)
PositionSequence
67-70KRKA
141-161HDKQKSSKKKNKKIKNIYLKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
KEGG nce:NCER_102671  -  
Amino Acid Sequences MKRKEEDRLSEDGKRICLEVRGFSIKNVETDVKDVSKKTNVIKNKNDANKKAVRKHLNAISAIIAGKRKAPKTGLKLYQVNDDGWISVKHTFKLKIYFGSNNKNNFKSYKKTNFNRFNSMEVENKIKETAPLYKKGHAVSHDKQKSSKKKNKKIKNIYLKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.3
4 0.3
5 0.27
6 0.25
7 0.28
8 0.32
9 0.31
10 0.31
11 0.35
12 0.3
13 0.29
14 0.29
15 0.26
16 0.2
17 0.22
18 0.25
19 0.22
20 0.24
21 0.24
22 0.24
23 0.27
24 0.29
25 0.33
26 0.38
27 0.44
28 0.5
29 0.56
30 0.6
31 0.64
32 0.69
33 0.71
34 0.67
35 0.65
36 0.64
37 0.65
38 0.65
39 0.66
40 0.64
41 0.6
42 0.63
43 0.62
44 0.57
45 0.49
46 0.42
47 0.34
48 0.27
49 0.24
50 0.18
51 0.13
52 0.1
53 0.14
54 0.17
55 0.18
56 0.19
57 0.23
58 0.29
59 0.35
60 0.43
61 0.44
62 0.45
63 0.48
64 0.46
65 0.47
66 0.42
67 0.35
68 0.27
69 0.22
70 0.16
71 0.14
72 0.13
73 0.09
74 0.12
75 0.13
76 0.13
77 0.16
78 0.18
79 0.19
80 0.24
81 0.24
82 0.23
83 0.26
84 0.32
85 0.34
86 0.42
87 0.45
88 0.48
89 0.51
90 0.49
91 0.48
92 0.45
93 0.45
94 0.42
95 0.47
96 0.49
97 0.55
98 0.62
99 0.7
100 0.77
101 0.77
102 0.79
103 0.71
104 0.63
105 0.57
106 0.51
107 0.45
108 0.37
109 0.37
110 0.29
111 0.28
112 0.26
113 0.22
114 0.21
115 0.19
116 0.27
117 0.26
118 0.34
119 0.37
120 0.41
121 0.44
122 0.45
123 0.46
124 0.42
125 0.46
126 0.45
127 0.53
128 0.55
129 0.54
130 0.58
131 0.64
132 0.7
133 0.73
134 0.76
135 0.76
136 0.8
137 0.89
138 0.93
139 0.94
140 0.94
141 0.94
142 0.95