Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VBG8

Protein Details
Accession C4VBG8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-25NKETSKKRLKSIVKERRALKBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
KEGG nce:NCER_102134  -  
Amino Acid Sequences MFTPLNKETSKKRLKSIVKERRALKETYYNFLLDIKKLDNIFSVKIDYEENYELLSQIKEYALYNCLLKNIDIDIKKYDIFRYKKVLFFYIKKTIENKEFIKAKKLLNICKERGYENNEYFDLLYKLKKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.79
4 0.79
5 0.78
6 0.81
7 0.8
8 0.79
9 0.74
10 0.64
11 0.58
12 0.57
13 0.5
14 0.48
15 0.44
16 0.35
17 0.31
18 0.34
19 0.31
20 0.22
21 0.21
22 0.17
23 0.19
24 0.19
25 0.19
26 0.18
27 0.18
28 0.18
29 0.17
30 0.17
31 0.14
32 0.14
33 0.15
34 0.12
35 0.13
36 0.13
37 0.12
38 0.11
39 0.11
40 0.1
41 0.1
42 0.1
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.08
57 0.08
58 0.13
59 0.13
60 0.14
61 0.15
62 0.16
63 0.17
64 0.17
65 0.19
66 0.23
67 0.26
68 0.28
69 0.35
70 0.37
71 0.39
72 0.41
73 0.43
74 0.39
75 0.4
76 0.43
77 0.45
78 0.43
79 0.42
80 0.43
81 0.44
82 0.44
83 0.46
84 0.41
85 0.39
86 0.44
87 0.43
88 0.47
89 0.45
90 0.42
91 0.44
92 0.49
93 0.48
94 0.52
95 0.59
96 0.55
97 0.57
98 0.56
99 0.52
100 0.52
101 0.52
102 0.51
103 0.46
104 0.48
105 0.41
106 0.41
107 0.38
108 0.34
109 0.3
110 0.23
111 0.25