Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3YF92

Protein Details
Accession G3YF92    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-43LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
26-42PKKKTSHMKKRHRQMAG
Subcellular Location(s) mito 13.5, mito_nucl 13.166, nucl 11.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LKPAAISLNIPGIMEGLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKSLSTCSGCGQVKRSHVLCPHCVESVKKQWKQTQTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.05
4 0.06
5 0.05
6 0.06
7 0.07
8 0.09
9 0.1
10 0.15
11 0.19
12 0.25
13 0.31
14 0.35
15 0.41
16 0.49
17 0.59
18 0.65
19 0.71
20 0.76
21 0.8
22 0.87
23 0.88
24 0.85
25 0.8
26 0.75
27 0.75
28 0.72
29 0.63
30 0.56
31 0.51
32 0.44
33 0.4
34 0.33
35 0.25
36 0.2
37 0.2
38 0.19
39 0.17
40 0.16
41 0.17
42 0.23
43 0.22
44 0.21
45 0.25
46 0.27
47 0.29
48 0.35
49 0.35
50 0.34
51 0.38
52 0.42
53 0.42
54 0.43
55 0.42
56 0.39
57 0.4
58 0.39
59 0.41
60 0.47
61 0.52
62 0.52
63 0.57
64 0.63