Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5AH29

Protein Details
Accession Q5AH29    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-32YFQTEKTTETRQQRQQKKRPVRNSIICTLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011767  GLR_AS  
IPR002109  Glutaredoxin  
IPR011899  Glutaredoxin_euk/vir  
IPR014025  Glutaredoxin_subgr  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0015038  F:glutathione disulfide oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
KEGG cal:CAALFM_C702080WA  -  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS00195  GLUTAREDOXIN_1  
PS51354  GLUTAREDOXIN_2  
CDD cd03419  GRX_GRXh_1_2_like  
Amino Acid Sequences MDYFQTEKTTETRQQRQQKKRPVRNSIICTLSLSYQPNFVMSSLIGWLSSWFQNEPITPELKKEIESNINSHKVLVYSKSYCPYCTSTKTLLQSLNQDYKVIELDQIPKGSAIQNGLQELTGQRTVPNVFINGKHIGGNSDIQALHSQGKLKPLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.74
3 0.82
4 0.85
5 0.88
6 0.9
7 0.91
8 0.91
9 0.91
10 0.91
11 0.89
12 0.86
13 0.81
14 0.72
15 0.62
16 0.53
17 0.44
18 0.35
19 0.29
20 0.25
21 0.19
22 0.19
23 0.19
24 0.17
25 0.17
26 0.15
27 0.13
28 0.1
29 0.1
30 0.08
31 0.08
32 0.07
33 0.06
34 0.07
35 0.08
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.14
43 0.15
44 0.16
45 0.15
46 0.16
47 0.19
48 0.18
49 0.19
50 0.16
51 0.18
52 0.22
53 0.23
54 0.25
55 0.27
56 0.29
57 0.28
58 0.26
59 0.23
60 0.18
61 0.17
62 0.16
63 0.15
64 0.15
65 0.16
66 0.21
67 0.21
68 0.21
69 0.23
70 0.25
71 0.24
72 0.26
73 0.28
74 0.28
75 0.31
76 0.33
77 0.33
78 0.31
79 0.29
80 0.3
81 0.31
82 0.32
83 0.28
84 0.26
85 0.23
86 0.22
87 0.22
88 0.17
89 0.13
90 0.1
91 0.14
92 0.16
93 0.16
94 0.16
95 0.14
96 0.15
97 0.15
98 0.15
99 0.14
100 0.14
101 0.15
102 0.16
103 0.16
104 0.15
105 0.14
106 0.14
107 0.15
108 0.14
109 0.12
110 0.12
111 0.14
112 0.15
113 0.17
114 0.17
115 0.16
116 0.18
117 0.19
118 0.22
119 0.22
120 0.22
121 0.21
122 0.2
123 0.18
124 0.18
125 0.19
126 0.16
127 0.17
128 0.16
129 0.16
130 0.18
131 0.18
132 0.19
133 0.19
134 0.22
135 0.2
136 0.29