Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3Y406

Protein Details
Accession G3Y406    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23GKRKKSSRQPQQPRKREPLPTTFHydrophilic
NLS Segment(s)
PositionSequence
3-9RKKSSRQ
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences GKRKKSSRQPQQPRKREPLPTTFACLFCNHENSIVVKLDKKLGLGNLSCKVCGQRFQTGINYLSAAVDVYSDWVDACDAVAKDTATKYEDSDPRVRRSNDFATSPSARDVGFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.88
3 0.86
4 0.82
5 0.79
6 0.75
7 0.67
8 0.64
9 0.58
10 0.51
11 0.43
12 0.37
13 0.33
14 0.29
15 0.3
16 0.24
17 0.22
18 0.22
19 0.22
20 0.24
21 0.21
22 0.19
23 0.18
24 0.18
25 0.2
26 0.19
27 0.18
28 0.17
29 0.16
30 0.18
31 0.17
32 0.2
33 0.22
34 0.22
35 0.21
36 0.2
37 0.21
38 0.18
39 0.22
40 0.22
41 0.22
42 0.23
43 0.25
44 0.27
45 0.27
46 0.27
47 0.22
48 0.19
49 0.14
50 0.12
51 0.1
52 0.08
53 0.05
54 0.04
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.04
63 0.05
64 0.07
65 0.07
66 0.08
67 0.09
68 0.09
69 0.1
70 0.11
71 0.13
72 0.11
73 0.12
74 0.14
75 0.21
76 0.25
77 0.29
78 0.38
79 0.41
80 0.45
81 0.53
82 0.53
83 0.49
84 0.53
85 0.54
86 0.51
87 0.49
88 0.45
89 0.44
90 0.44
91 0.41
92 0.36
93 0.3