Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3YB64

Protein Details
Accession G3YB64    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
133-153GVFQLQKKIKRTRVTRMWYRRHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 16, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006137  NADH_UbQ_OxRdtase-like_20kDa  
IPR006138  NADH_UQ_OxRdtase_20Kd_su  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
GO:0048038  F:quinone binding  
Pfam View protein in Pfam  
PF01058  Oxidored_q6  
PROSITE View protein in PROSITE  
PS01150  COMPLEX1_20K  
Amino Acid Sequences DFPSTTFDQIVNWARQGSLWPLSFGLACCAIEMMHVSMPRYDQDRLGIIFRASPRQSDVMIVAGTVTNKMAPALRQCYDQMPEPRWVISMGSCANGGGYYHYSYSIVRGVDRIVPVDVYIPGCPPTAEATLYGVFQLQKKIKRTRVTRMWYRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.23
5 0.23
6 0.21
7 0.21
8 0.2
9 0.21
10 0.22
11 0.2
12 0.17
13 0.12
14 0.12
15 0.11
16 0.1
17 0.09
18 0.09
19 0.1
20 0.09
21 0.1
22 0.11
23 0.11
24 0.12
25 0.13
26 0.15
27 0.17
28 0.16
29 0.15
30 0.16
31 0.18
32 0.18
33 0.19
34 0.18
35 0.15
36 0.17
37 0.17
38 0.22
39 0.2
40 0.2
41 0.2
42 0.21
43 0.21
44 0.19
45 0.18
46 0.13
47 0.12
48 0.11
49 0.08
50 0.07
51 0.07
52 0.06
53 0.06
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.1
60 0.14
61 0.15
62 0.16
63 0.17
64 0.19
65 0.2
66 0.24
67 0.24
68 0.22
69 0.25
70 0.24
71 0.23
72 0.22
73 0.21
74 0.16
75 0.12
76 0.13
77 0.1
78 0.1
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.08
86 0.08
87 0.08
88 0.09
89 0.1
90 0.1
91 0.11
92 0.13
93 0.11
94 0.11
95 0.11
96 0.12
97 0.14
98 0.15
99 0.14
100 0.12
101 0.11
102 0.11
103 0.12
104 0.12
105 0.1
106 0.1
107 0.1
108 0.11
109 0.11
110 0.11
111 0.11
112 0.13
113 0.13
114 0.14
115 0.13
116 0.15
117 0.16
118 0.16
119 0.15
120 0.13
121 0.13
122 0.14
123 0.22
124 0.26
125 0.32
126 0.41
127 0.51
128 0.58
129 0.66
130 0.71
131 0.74
132 0.77
133 0.8