Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5ABC6

Protein Details
Accession Q5ABC6   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-27RGLGRGSKKNKKDLEPSNNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Gene Ontology GO:0005938  C:cell cortex  
GO:0032153  C:cell division site  
GO:0030428  C:cell septum  
GO:0005935  C:cellular bud neck  
GO:0005934  C:cellular bud tip  
GO:0005737  C:cytoplasm  
GO:0001411  C:hyphal tip  
GO:0043332  C:mating projection tip  
GO:0005634  C:nucleus  
GO:1902554  C:serine/threonine protein kinase complex  
GO:0030295  F:protein kinase activator activity  
GO:0007118  P:budding cell apical bud growth  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0036244  P:cellular response to neutral pH  
GO:0009267  P:cellular response to starvation  
GO:0030866  P:cortical actin cytoskeleton organization  
GO:0007163  P:establishment or maintenance of cell polarity  
GO:0030447  P:filamentous growth  
GO:0036180  P:filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0036178  P:filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:0036170  P:filamentous growth of a population of unicellular organisms in response to starvation  
GO:0031505  P:fungal-type cell wall organization  
GO:0030448  P:hyphal growth  
GO:0031579  P:membrane raft organization  
GO:1900445  P:positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0001934  P:positive regulation of protein phosphorylation  
GO:1900233  P:positive regulation of single-species biofilm formation on inanimate substrate  
GO:0006468  P:protein phosphorylation  
GO:0062200  P:RAM/MOR signaling pathway  
GO:2000100  P:regulation of establishment or maintenance of bipolar cell polarity regulating cell shape  
GO:0000920  P:septum digestion after cytokinesis  
GO:0007165  P:signal transduction  
GO:0044011  P:single-species biofilm formation on inanimate substrate  
KEGG cal:CAALFM_C100620WA  -  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MSFLNTIRGLGRGSKKNKKDLEPSNNAIYSHSNLSGNGLRRTQSPTKFSPSKLSSKGAQGSAAYTSSPTKRSRTGQSLQHQDSQSSLQYQQQSGSVSPSKRSSIQTTKSTTVNADPPLFLCEPYVKTALVKGSFKTIVQLPKYVDYCEWLALNIFELFNHLNRFYGVIQEYATPEAYPTMNAGPNTNYLWVNSSGQAVNLPACQYIEYVITWVTNKLNDQSVFPTKNGGAFPPNFIKDCKNISRQMFRIFAHIYHNHFDKIIHLSLEAHWNSFFAHFISFVKEFNLIDRTEMEPLLPLIENFEQQGKITQASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.71
4 0.77
5 0.77
6 0.78
7 0.79
8 0.8
9 0.79
10 0.77
11 0.74
12 0.68
13 0.6
14 0.52
15 0.45
16 0.37
17 0.32
18 0.29
19 0.23
20 0.2
21 0.25
22 0.28
23 0.3
24 0.31
25 0.3
26 0.28
27 0.3
28 0.38
29 0.42
30 0.43
31 0.45
32 0.46
33 0.53
34 0.57
35 0.57
36 0.59
37 0.56
38 0.57
39 0.56
40 0.55
41 0.49
42 0.5
43 0.53
44 0.44
45 0.4
46 0.32
47 0.28
48 0.26
49 0.23
50 0.16
51 0.13
52 0.16
53 0.17
54 0.22
55 0.24
56 0.26
57 0.32
58 0.38
59 0.45
60 0.49
61 0.53
62 0.57
63 0.62
64 0.68
65 0.65
66 0.66
67 0.59
68 0.51
69 0.45
70 0.39
71 0.31
72 0.24
73 0.22
74 0.19
75 0.22
76 0.22
77 0.21
78 0.21
79 0.21
80 0.19
81 0.22
82 0.23
83 0.21
84 0.24
85 0.26
86 0.26
87 0.28
88 0.31
89 0.34
90 0.38
91 0.43
92 0.46
93 0.49
94 0.49
95 0.46
96 0.44
97 0.37
98 0.31
99 0.29
100 0.25
101 0.21
102 0.18
103 0.18
104 0.21
105 0.2
106 0.17
107 0.14
108 0.13
109 0.14
110 0.16
111 0.17
112 0.13
113 0.13
114 0.14
115 0.17
116 0.18
117 0.17
118 0.15
119 0.18
120 0.18
121 0.18
122 0.18
123 0.19
124 0.21
125 0.21
126 0.24
127 0.21
128 0.25
129 0.26
130 0.24
131 0.21
132 0.17
133 0.16
134 0.14
135 0.13
136 0.09
137 0.08
138 0.07
139 0.08
140 0.07
141 0.06
142 0.05
143 0.07
144 0.07
145 0.08
146 0.1
147 0.09
148 0.08
149 0.09
150 0.11
151 0.09
152 0.11
153 0.11
154 0.1
155 0.1
156 0.11
157 0.11
158 0.11
159 0.11
160 0.08
161 0.07
162 0.08
163 0.07
164 0.07
165 0.07
166 0.08
167 0.1
168 0.11
169 0.12
170 0.12
171 0.13
172 0.14
173 0.15
174 0.13
175 0.11
176 0.13
177 0.14
178 0.14
179 0.13
180 0.14
181 0.12
182 0.12
183 0.12
184 0.1
185 0.09
186 0.09
187 0.09
188 0.07
189 0.07
190 0.08
191 0.07
192 0.08
193 0.08
194 0.07
195 0.07
196 0.07
197 0.08
198 0.08
199 0.09
200 0.1
201 0.1
202 0.11
203 0.12
204 0.17
205 0.17
206 0.18
207 0.22
208 0.29
209 0.29
210 0.28
211 0.3
212 0.25
213 0.27
214 0.26
215 0.23
216 0.21
217 0.2
218 0.24
219 0.27
220 0.29
221 0.27
222 0.28
223 0.3
224 0.29
225 0.35
226 0.37
227 0.38
228 0.43
229 0.48
230 0.55
231 0.56
232 0.57
233 0.55
234 0.48
235 0.48
236 0.42
237 0.37
238 0.36
239 0.36
240 0.34
241 0.34
242 0.36
243 0.31
244 0.3
245 0.28
246 0.24
247 0.25
248 0.23
249 0.19
250 0.17
251 0.18
252 0.19
253 0.27
254 0.25
255 0.21
256 0.19
257 0.18
258 0.19
259 0.18
260 0.17
261 0.1
262 0.1
263 0.1
264 0.11
265 0.16
266 0.16
267 0.16
268 0.17
269 0.18
270 0.17
271 0.2
272 0.23
273 0.17
274 0.18
275 0.21
276 0.21
277 0.21
278 0.21
279 0.18
280 0.15
281 0.15
282 0.16
283 0.14
284 0.12
285 0.14
286 0.16
287 0.17
288 0.17
289 0.2
290 0.18
291 0.18
292 0.23
293 0.21