Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3Y3F1

Protein Details
Accession G3Y3F1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-34QPDPVRRTRKGTPKKDPIKKELABasic
NLS Segment(s)
PositionSequence
17-55RRTRKGTPKKDPIKKELAGWREKVEAGEEHTGKPGRRKF
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MIQGQGELNRIQPDPVRRTRKGTPKKDPIKKELAGWREKVEAGEEHTGKPGRRKFRGCGIPSEVLGRWEPKPAPKLNGWWIGGFVDSPQQLGRCPGDQIRCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.45
3 0.51
4 0.51
5 0.57
6 0.64
7 0.71
8 0.73
9 0.75
10 0.76
11 0.78
12 0.85
13 0.88
14 0.86
15 0.82
16 0.79
17 0.7
18 0.66
19 0.63
20 0.59
21 0.54
22 0.49
23 0.44
24 0.37
25 0.36
26 0.29
27 0.24
28 0.18
29 0.17
30 0.2
31 0.19
32 0.17
33 0.2
34 0.22
35 0.21
36 0.28
37 0.3
38 0.32
39 0.38
40 0.42
41 0.42
42 0.49
43 0.58
44 0.52
45 0.52
46 0.5
47 0.45
48 0.41
49 0.41
50 0.31
51 0.24
52 0.23
53 0.2
54 0.15
55 0.18
56 0.19
57 0.22
58 0.28
59 0.3
60 0.33
61 0.34
62 0.39
63 0.42
64 0.47
65 0.43
66 0.37
67 0.34
68 0.3
69 0.28
70 0.22
71 0.15
72 0.13
73 0.12
74 0.12
75 0.13
76 0.13
77 0.14
78 0.19
79 0.22
80 0.18
81 0.22
82 0.28