Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GLW6

Protein Details
Accession Q2GLW6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-58QLGGGRCRKRRVGRCRVGRLARRRWRWEVQBasic
NLS Segment(s)
PositionSequence
36-56RKRRVGRCRVGRLARRRWRWE
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MVAGPDRPFRLAPGRGAGVGGVGRCRVGQLGGGRCRKRRVGRCRVGRLARRRWRWEVQGRRVGEVRPPSLRGGPLHLCTWSRASEPISSKTHTNAFCGIEKSTPEPAGPCKALRPGRWVYEKGEARAARAAKAASNGAQGYYWLASTALAGMRGPPPRFVRVRCTFPSQAADGPISYIAAFAWCPTVCRGTDDCGEHHPSTAAALAHPPGGQRGIWEDSIQAQGNTPYAPRGGLCGCLAVRHTCSKPPGVPTGWGRLRAEPPGRASSWGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.33
4 0.29
5 0.22
6 0.2
7 0.17
8 0.13
9 0.11
10 0.11
11 0.11
12 0.12
13 0.11
14 0.1
15 0.14
16 0.19
17 0.28
18 0.36
19 0.45
20 0.51
21 0.55
22 0.61
23 0.65
24 0.69
25 0.7
26 0.72
27 0.75
28 0.79
29 0.85
30 0.88
31 0.89
32 0.88
33 0.87
34 0.86
35 0.86
36 0.85
37 0.84
38 0.82
39 0.8
40 0.78
41 0.79
42 0.79
43 0.79
44 0.79
45 0.78
46 0.71
47 0.67
48 0.62
49 0.53
50 0.48
51 0.44
52 0.38
53 0.33
54 0.34
55 0.33
56 0.33
57 0.34
58 0.29
59 0.29
60 0.29
61 0.28
62 0.27
63 0.26
64 0.24
65 0.23
66 0.25
67 0.2
68 0.17
69 0.17
70 0.18
71 0.22
72 0.25
73 0.29
74 0.3
75 0.3
76 0.3
77 0.3
78 0.34
79 0.29
80 0.27
81 0.25
82 0.25
83 0.25
84 0.26
85 0.24
86 0.19
87 0.2
88 0.21
89 0.2
90 0.18
91 0.16
92 0.16
93 0.17
94 0.2
95 0.21
96 0.18
97 0.17
98 0.24
99 0.29
100 0.29
101 0.33
102 0.32
103 0.36
104 0.4
105 0.4
106 0.35
107 0.4
108 0.4
109 0.35
110 0.38
111 0.32
112 0.29
113 0.31
114 0.29
115 0.21
116 0.2
117 0.19
118 0.13
119 0.14
120 0.13
121 0.1
122 0.11
123 0.1
124 0.09
125 0.08
126 0.08
127 0.07
128 0.07
129 0.06
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.04
136 0.04
137 0.04
138 0.06
139 0.09
140 0.14
141 0.15
142 0.18
143 0.21
144 0.26
145 0.3
146 0.31
147 0.37
148 0.38
149 0.44
150 0.43
151 0.47
152 0.43
153 0.42
154 0.42
155 0.35
156 0.3
157 0.25
158 0.22
159 0.15
160 0.14
161 0.12
162 0.09
163 0.08
164 0.06
165 0.05
166 0.05
167 0.05
168 0.04
169 0.07
170 0.07
171 0.08
172 0.1
173 0.12
174 0.12
175 0.17
176 0.18
177 0.19
178 0.24
179 0.25
180 0.25
181 0.27
182 0.33
183 0.28
184 0.27
185 0.24
186 0.19
187 0.18
188 0.19
189 0.14
190 0.09
191 0.1
192 0.1
193 0.11
194 0.11
195 0.11
196 0.1
197 0.11
198 0.1
199 0.1
200 0.14
201 0.16
202 0.17
203 0.17
204 0.16
205 0.17
206 0.21
207 0.21
208 0.16
209 0.14
210 0.14
211 0.15
212 0.15
213 0.13
214 0.11
215 0.11
216 0.11
217 0.1
218 0.13
219 0.13
220 0.15
221 0.15
222 0.17
223 0.16
224 0.18
225 0.2
226 0.19
227 0.22
228 0.27
229 0.29
230 0.31
231 0.35
232 0.4
233 0.42
234 0.43
235 0.47
236 0.42
237 0.47
238 0.45
239 0.51
240 0.5
241 0.51
242 0.48
243 0.47
244 0.48
245 0.5
246 0.52
247 0.46
248 0.48
249 0.48
250 0.47