Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3Y8A2

Protein Details
Accession G3Y8A2   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
197-217DTENRRCGRRIKPRLPMREVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016446  Flavin_OxRdtase_Frp  
IPR029479  Nitroreductase  
IPR000415  Nitroreductase-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00881  Nitroreductase  
Amino Acid Sequences MTRTISSLAEERYRDSQSSNFPLPTDPSNSLPATLSAILSHKSCRAFLPSKLPPGTLETLISAAQSGSSSSLMQTWDVIAIQDPEHKSNVASLAADLDFIRQAPLFLVFCPNLRRLKNLSEQYGHQSAEALDSMNMFIMSTVDSAIAAQNVAIAAESLGLGICYVGALRNNAEEVCKLLNLPPLTWGVFGMAIGYPDTENRRCGRRIKPRLPMREVLHFERWNEEGQKDNVESYDKALGTFYEEEAKFGRKGWGEFVAGMVASQDQGGREKVRQVIESQGFKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.33
4 0.36
5 0.42
6 0.43
7 0.39
8 0.36
9 0.38
10 0.38
11 0.36
12 0.34
13 0.3
14 0.28
15 0.32
16 0.31
17 0.3
18 0.27
19 0.24
20 0.22
21 0.19
22 0.17
23 0.13
24 0.15
25 0.16
26 0.16
27 0.17
28 0.18
29 0.19
30 0.2
31 0.21
32 0.27
33 0.3
34 0.33
35 0.41
36 0.42
37 0.49
38 0.49
39 0.48
40 0.41
41 0.42
42 0.4
43 0.31
44 0.26
45 0.19
46 0.19
47 0.18
48 0.16
49 0.11
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.09
59 0.09
60 0.09
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.08
69 0.13
70 0.14
71 0.15
72 0.16
73 0.16
74 0.15
75 0.16
76 0.17
77 0.13
78 0.11
79 0.09
80 0.1
81 0.1
82 0.1
83 0.09
84 0.07
85 0.07
86 0.07
87 0.08
88 0.06
89 0.06
90 0.06
91 0.08
92 0.08
93 0.08
94 0.11
95 0.11
96 0.13
97 0.15
98 0.19
99 0.23
100 0.23
101 0.27
102 0.27
103 0.32
104 0.39
105 0.41
106 0.41
107 0.37
108 0.37
109 0.38
110 0.38
111 0.32
112 0.24
113 0.2
114 0.16
115 0.15
116 0.13
117 0.09
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.03
130 0.03
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.03
143 0.03
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.04
154 0.05
155 0.06
156 0.06
157 0.07
158 0.07
159 0.08
160 0.07
161 0.08
162 0.08
163 0.08
164 0.08
165 0.09
166 0.14
167 0.14
168 0.14
169 0.14
170 0.15
171 0.16
172 0.15
173 0.14
174 0.09
175 0.09
176 0.08
177 0.07
178 0.06
179 0.06
180 0.06
181 0.06
182 0.05
183 0.08
184 0.13
185 0.14
186 0.17
187 0.2
188 0.25
189 0.29
190 0.36
191 0.44
192 0.51
193 0.6
194 0.66
195 0.73
196 0.77
197 0.83
198 0.82
199 0.79
200 0.72
201 0.7
202 0.66
203 0.62
204 0.61
205 0.53
206 0.48
207 0.43
208 0.41
209 0.36
210 0.33
211 0.28
212 0.26
213 0.25
214 0.29
215 0.26
216 0.26
217 0.23
218 0.23
219 0.22
220 0.19
221 0.23
222 0.19
223 0.18
224 0.18
225 0.17
226 0.18
227 0.19
228 0.17
229 0.2
230 0.2
231 0.21
232 0.23
233 0.26
234 0.22
235 0.23
236 0.28
237 0.23
238 0.24
239 0.27
240 0.29
241 0.28
242 0.28
243 0.27
244 0.22
245 0.18
246 0.16
247 0.13
248 0.08
249 0.07
250 0.07
251 0.07
252 0.07
253 0.1
254 0.14
255 0.17
256 0.2
257 0.25
258 0.3
259 0.34
260 0.34
261 0.34
262 0.4
263 0.45
264 0.46