Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TRV1

Protein Details
Accession A7TRV1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAPRESKKRTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
5-23RESKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG vpo:Kpol_376p1  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAPRESKKRTTRRKKDPNAPKRALSAYMFFANETRDIVRAENPDVSFGQVGRILGEKWKALTPEDKVPFEAKAEADKKRYESEKELYNATLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.94
4 0.95
5 0.94
6 0.93
7 0.87
8 0.78
9 0.71
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.19
19 0.16
20 0.15
21 0.13
22 0.11
23 0.1
24 0.1
25 0.11
26 0.14
27 0.14
28 0.15
29 0.17
30 0.17
31 0.17
32 0.16
33 0.16
34 0.13
35 0.11
36 0.1
37 0.08
38 0.08
39 0.07
40 0.08
41 0.07
42 0.09
43 0.11
44 0.1
45 0.11
46 0.13
47 0.13
48 0.14
49 0.18
50 0.2
51 0.28
52 0.32
53 0.31
54 0.31
55 0.32
56 0.31
57 0.28
58 0.27
59 0.18
60 0.22
61 0.26
62 0.29
63 0.32
64 0.35
65 0.37
66 0.42
67 0.46
68 0.43
69 0.45
70 0.46
71 0.5
72 0.49
73 0.48