Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3XQH4

Protein Details
Accession G3XQH4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAAKKRSIRRRRSSSKRSTYQQRNRRRNSLFLHydrophilic
NLS Segment(s)
PositionSequence
4-18KKRSIRRRRSSSKRS
Subcellular Location(s) nucl 18.5, mito_nucl 13.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAAKKRSIRRRRSSSKRSTYQQRNRRRNSLFLKAFEYCNLCEADIALVIRLKHNGQVFKFNSNSQWHPSREELVGNLYNSLKDMSYPKPREITWCELAAQYEIGEAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.91
4 0.89
5 0.89
6 0.89
7 0.89
8 0.88
9 0.88
10 0.88
11 0.87
12 0.88
13 0.81
14 0.79
15 0.76
16 0.77
17 0.71
18 0.62
19 0.59
20 0.51
21 0.48
22 0.4
23 0.36
24 0.25
25 0.21
26 0.19
27 0.14
28 0.12
29 0.12
30 0.1
31 0.08
32 0.08
33 0.06
34 0.07
35 0.07
36 0.08
37 0.09
38 0.09
39 0.11
40 0.14
41 0.17
42 0.17
43 0.25
44 0.26
45 0.29
46 0.3
47 0.28
48 0.29
49 0.3
50 0.32
51 0.28
52 0.33
53 0.3
54 0.32
55 0.33
56 0.31
57 0.28
58 0.27
59 0.22
60 0.21
61 0.22
62 0.19
63 0.19
64 0.16
65 0.15
66 0.15
67 0.15
68 0.1
69 0.09
70 0.13
71 0.18
72 0.29
73 0.33
74 0.36
75 0.39
76 0.4
77 0.45
78 0.48
79 0.49
80 0.42
81 0.4
82 0.38
83 0.35
84 0.36
85 0.29
86 0.23
87 0.16
88 0.13