Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3XNK2

Protein Details
Accession G3XNK2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-36NIPTSSSSHHHKRRWRNKGKQREQDTIPHydrophilic
NLS Segment(s)
PositionSequence
20-28KRRWRNKGK
Subcellular Location(s) mito_nucl 11.333, nucl 10.5, mito 10, cyto_nucl 8.166, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSFWNPTNIPTSSSSHHHKRRWRNKGKQREQDTIPLFGSSTPAPHRQRSSSSRSDDIVLVRRKGSPPWWWLLCTKGTMGITVMRAVRDEHGARRPRGQLVLEPLFEGKVASFFPTKLVDVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.44
4 0.53
5 0.57
6 0.64
7 0.71
8 0.78
9 0.84
10 0.87
11 0.88
12 0.89
13 0.93
14 0.95
15 0.94
16 0.9
17 0.86
18 0.78
19 0.76
20 0.68
21 0.59
22 0.49
23 0.38
24 0.31
25 0.24
26 0.22
27 0.13
28 0.13
29 0.13
30 0.22
31 0.25
32 0.29
33 0.32
34 0.33
35 0.4
36 0.43
37 0.47
38 0.46
39 0.47
40 0.44
41 0.42
42 0.4
43 0.35
44 0.31
45 0.31
46 0.27
47 0.24
48 0.22
49 0.23
50 0.22
51 0.22
52 0.24
53 0.22
54 0.22
55 0.27
56 0.27
57 0.28
58 0.28
59 0.29
60 0.26
61 0.21
62 0.18
63 0.16
64 0.15
65 0.14
66 0.14
67 0.13
68 0.12
69 0.14
70 0.14
71 0.11
72 0.11
73 0.12
74 0.12
75 0.16
76 0.17
77 0.2
78 0.28
79 0.35
80 0.36
81 0.41
82 0.43
83 0.41
84 0.43
85 0.4
86 0.37
87 0.38
88 0.41
89 0.35
90 0.33
91 0.3
92 0.26
93 0.24
94 0.19
95 0.11
96 0.08
97 0.08
98 0.11
99 0.12
100 0.12
101 0.15
102 0.18
103 0.18