Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H068

Protein Details
Accession Q2H068    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
19-43NFGKTGRVARKKKESRRADRKHLTGBasic
NLS Segment(s)
PositionSequence
24-39GRVARKKKESRRADRK
Subcellular Location(s) nucl 13, cyto 10, pero 3
Family & Domain DBs
Amino Acid Sequences MVIKSRLGYVQFDIDEDDNFGKTGRVARKKKESRRADRKHLTGNAARELFLECLQLLLRKQVLWLIDYVPKEWRDRLPGWAHHSLLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.17
5 0.12
6 0.12
7 0.12
8 0.09
9 0.1
10 0.16
11 0.23
12 0.33
13 0.38
14 0.46
15 0.57
16 0.67
17 0.76
18 0.8
19 0.81
20 0.82
21 0.88
22 0.88
23 0.87
24 0.85
25 0.79
26 0.76
27 0.69
28 0.62
29 0.55
30 0.49
31 0.43
32 0.35
33 0.31
34 0.23
35 0.22
36 0.18
37 0.14
38 0.12
39 0.08
40 0.08
41 0.08
42 0.1
43 0.09
44 0.1
45 0.11
46 0.1
47 0.11
48 0.12
49 0.13
50 0.12
51 0.12
52 0.12
53 0.16
54 0.17
55 0.18
56 0.21
57 0.22
58 0.25
59 0.27
60 0.29
61 0.32
62 0.33
63 0.4
64 0.42
65 0.47
66 0.52
67 0.54
68 0.51