Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3Y9X0

Protein Details
Accession G3Y9X0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-40VCLSVLSKIKKKKEKDKVCCTSLPHydrophilic
NLS Segment(s)
PositionSequence
26-29KKKK
Subcellular Location(s) extr 13, cyto 6, mito 2, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MCLLCAKFWASLVCLSVCLSVLSKIKKKKEKDKVCCTSLPPPKTPGPEPCPCDNAACPSNPLPANPLSFYLFLFGKGKEWERLEKAGLEWAGDRSWPDRHVALPSLVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.13
5 0.11
6 0.11
7 0.13
8 0.18
9 0.23
10 0.3
11 0.37
12 0.47
13 0.55
14 0.63
15 0.7
16 0.76
17 0.8
18 0.84
19 0.87
20 0.85
21 0.81
22 0.75
23 0.68
24 0.66
25 0.64
26 0.58
27 0.49
28 0.46
29 0.45
30 0.46
31 0.45
32 0.44
33 0.41
34 0.43
35 0.46
36 0.43
37 0.42
38 0.38
39 0.36
40 0.29
41 0.27
42 0.22
43 0.18
44 0.18
45 0.16
46 0.2
47 0.19
48 0.18
49 0.16
50 0.17
51 0.18
52 0.17
53 0.18
54 0.15
55 0.15
56 0.15
57 0.15
58 0.13
59 0.13
60 0.14
61 0.12
62 0.13
63 0.15
64 0.18
65 0.21
66 0.24
67 0.28
68 0.3
69 0.33
70 0.32
71 0.3
72 0.28
73 0.28
74 0.26
75 0.21
76 0.18
77 0.17
78 0.16
79 0.15
80 0.16
81 0.14
82 0.17
83 0.17
84 0.2
85 0.2
86 0.21
87 0.26
88 0.27