Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3XRL4

Protein Details
Accession G3XRL4    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
359-387LSVTRGKGFTKEKNKKKRGSYRGGPIDISHydrophilic
NLS Segment(s)
PositionSequence
138-146KKPAAPAAK
365-378KGFTKEKNKKKRGS
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MAGQKSKQAKPAKASKSKETPAPPAQLVAALSAFLSESGFSKTKEAFTKELASKSIDSDAKNVPSLLELYQSWEKSSEKSSGSSSSDSDSDSESESGSESDSESSDSSSDESSDSDVEMNDKSESDSDSDSDDEEEKKKPAAPAAKSQGTKRKAESSSSESDSESEADEAPKSKKTKVTSAMEESSDSDSSDSESDSSSSSSESEESSDSDSSSDDSSSSSSESDSDSDSDSDSDSSSDDEDDKKDDKKADKKALKAATKTPLPPSESSSSGSSPSSSSDSDTTGTVSNSDSAPKEQSKSAQTSYSSSASPAPGNGPQKKKHTGARPTPLAQLSELPTDHLLSNDYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.76
5 0.75
6 0.71
7 0.7
8 0.67
9 0.67
10 0.58
11 0.5
12 0.45
13 0.39
14 0.33
15 0.25
16 0.18
17 0.11
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.05
24 0.06
25 0.12
26 0.14
27 0.15
28 0.19
29 0.21
30 0.26
31 0.33
32 0.36
33 0.34
34 0.36
35 0.44
36 0.45
37 0.46
38 0.42
39 0.38
40 0.35
41 0.33
42 0.36
43 0.31
44 0.28
45 0.29
46 0.32
47 0.32
48 0.32
49 0.3
50 0.23
51 0.21
52 0.21
53 0.17
54 0.15
55 0.12
56 0.17
57 0.22
58 0.22
59 0.22
60 0.23
61 0.24
62 0.23
63 0.27
64 0.26
65 0.22
66 0.24
67 0.26
68 0.28
69 0.3
70 0.29
71 0.27
72 0.24
73 0.23
74 0.22
75 0.2
76 0.17
77 0.15
78 0.15
79 0.14
80 0.12
81 0.11
82 0.11
83 0.1
84 0.09
85 0.09
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1
112 0.11
113 0.11
114 0.1
115 0.12
116 0.12
117 0.11
118 0.12
119 0.12
120 0.13
121 0.14
122 0.16
123 0.15
124 0.16
125 0.19
126 0.19
127 0.23
128 0.29
129 0.3
130 0.37
131 0.43
132 0.48
133 0.47
134 0.51
135 0.54
136 0.5
137 0.5
138 0.44
139 0.45
140 0.41
141 0.42
142 0.43
143 0.4
144 0.4
145 0.4
146 0.38
147 0.3
148 0.29
149 0.26
150 0.21
151 0.15
152 0.11
153 0.09
154 0.08
155 0.09
156 0.1
157 0.11
158 0.16
159 0.18
160 0.2
161 0.25
162 0.27
163 0.34
164 0.4
165 0.44
166 0.43
167 0.46
168 0.45
169 0.4
170 0.37
171 0.32
172 0.26
173 0.2
174 0.16
175 0.11
176 0.09
177 0.09
178 0.09
179 0.07
180 0.06
181 0.06
182 0.06
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.07
190 0.07
191 0.07
192 0.07
193 0.08
194 0.1
195 0.09
196 0.09
197 0.09
198 0.09
199 0.08
200 0.08
201 0.08
202 0.06
203 0.06
204 0.07
205 0.07
206 0.07
207 0.07
208 0.06
209 0.07
210 0.07
211 0.08
212 0.08
213 0.09
214 0.09
215 0.09
216 0.09
217 0.09
218 0.09
219 0.08
220 0.07
221 0.07
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.08
228 0.09
229 0.12
230 0.14
231 0.16
232 0.18
233 0.23
234 0.3
235 0.37
236 0.45
237 0.52
238 0.56
239 0.58
240 0.63
241 0.66
242 0.64
243 0.58
244 0.55
245 0.51
246 0.5
247 0.48
248 0.45
249 0.41
250 0.39
251 0.37
252 0.37
253 0.34
254 0.32
255 0.32
256 0.29
257 0.25
258 0.23
259 0.22
260 0.18
261 0.15
262 0.15
263 0.15
264 0.13
265 0.15
266 0.14
267 0.15
268 0.15
269 0.15
270 0.15
271 0.13
272 0.13
273 0.11
274 0.11
275 0.11
276 0.1
277 0.13
278 0.12
279 0.13
280 0.18
281 0.2
282 0.22
283 0.23
284 0.28
285 0.31
286 0.34
287 0.35
288 0.34
289 0.32
290 0.33
291 0.35
292 0.32
293 0.27
294 0.23
295 0.23
296 0.21
297 0.2
298 0.17
299 0.16
300 0.21
301 0.29
302 0.36
303 0.41
304 0.46
305 0.53
306 0.59
307 0.61
308 0.64
309 0.65
310 0.68
311 0.71
312 0.74
313 0.73
314 0.69
315 0.69
316 0.63
317 0.54
318 0.45
319 0.39
320 0.32
321 0.29
322 0.26
323 0.22
324 0.2
325 0.21
326 0.2
327 0.16
328 0.16
329 0.13
330 0.15
331 0.14
332 0.13
333 0.11
334 0.12
335 0.13
336 0.13
337 0.12
338 0.12
339 0.13
340 0.14
341 0.16
342 0.16
343 0.14
344 0.14
345 0.16
346 0.19
347 0.24
348 0.24
349 0.23
350 0.26
351 0.27
352 0.33
353 0.38
354 0.44
355 0.49
356 0.59
357 0.68
358 0.76
359 0.85
360 0.87
361 0.9
362 0.91
363 0.9
364 0.9
365 0.89
366 0.88
367 0.88
368 0.82
369 0.72
370 0.62
371 0.57
372 0.48
373 0.43
374 0.34
375 0.26
376 0.23