Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3YGB0

Protein Details
Accession G3YGB0   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-100TRYGIRHPRHRPPKNIGRRSGBasic
NLS Segment(s)
PositionSequence
86-98HPRHRPPKNIGRR
Subcellular Location(s) mito 17, nucl 4, cyto 3, extr 3
Family & Domain DBs
Amino Acid Sequences MGRDWRRQPARQEGVEGAALIGDRRPELAGGGFGLDTFGIRAVFAPYRQFGRTPRVPQRFGLSCTYPSSTRLVSGNQTVTRYGIRHPRHRPPKNIGRRSGFPGASARAVLGGGGLGSHTLGGLLMVLEPDQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.35
4 0.24
5 0.16
6 0.14
7 0.1
8 0.09
9 0.07
10 0.07
11 0.07
12 0.08
13 0.08
14 0.09
15 0.09
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.04
25 0.05
26 0.04
27 0.04
28 0.05
29 0.07
30 0.09
31 0.1
32 0.12
33 0.13
34 0.16
35 0.17
36 0.19
37 0.19
38 0.26
39 0.32
40 0.37
41 0.46
42 0.5
43 0.51
44 0.5
45 0.53
46 0.48
47 0.45
48 0.4
49 0.32
50 0.27
51 0.27
52 0.28
53 0.22
54 0.2
55 0.19
56 0.15
57 0.15
58 0.14
59 0.14
60 0.14
61 0.16
62 0.18
63 0.17
64 0.18
65 0.17
66 0.17
67 0.17
68 0.16
69 0.17
70 0.23
71 0.28
72 0.37
73 0.44
74 0.54
75 0.63
76 0.7
77 0.74
78 0.75
79 0.79
80 0.81
81 0.82
82 0.8
83 0.75
84 0.71
85 0.7
86 0.68
87 0.57
88 0.47
89 0.43
90 0.37
91 0.32
92 0.28
93 0.21
94 0.14
95 0.14
96 0.11
97 0.08
98 0.05
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.04
112 0.04
113 0.04