Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3XNI2

Protein Details
Accession G3XNI2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
175-202MAAAERENAKRKKRKAIPERKRRTASASHydrophilic
NLS Segment(s)
PositionSequence
182-198NAKRKKRKAIPERKRRT
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MYPFLPWSQNQSSVRSSLSEATTSTQNVSFSFSFGSSCSPTSMPPPPPPSPTDSLLDITPRKCSFSSGYEMNNSCAFPSWPNRPSLLSADSDSSTASAYLSDEDLLPIGSGSPCESAIDEESAAQDPTMGDVDLTTEQQIQMIRAAAEEEAQRARFLAQVQAHARAQQAMRVAQMAAAERENAKRKKRKAIPERKRRTASASKATVCRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.31
4 0.27
5 0.26
6 0.23
7 0.21
8 0.21
9 0.23
10 0.22
11 0.22
12 0.19
13 0.18
14 0.17
15 0.21
16 0.18
17 0.17
18 0.17
19 0.15
20 0.14
21 0.14
22 0.17
23 0.14
24 0.15
25 0.16
26 0.15
27 0.16
28 0.21
29 0.27
30 0.28
31 0.34
32 0.4
33 0.41
34 0.44
35 0.45
36 0.46
37 0.43
38 0.41
39 0.37
40 0.31
41 0.3
42 0.27
43 0.29
44 0.27
45 0.23
46 0.26
47 0.24
48 0.25
49 0.24
50 0.26
51 0.25
52 0.25
53 0.29
54 0.26
55 0.28
56 0.3
57 0.31
58 0.3
59 0.28
60 0.24
61 0.19
62 0.17
63 0.15
64 0.13
65 0.18
66 0.23
67 0.24
68 0.26
69 0.27
70 0.27
71 0.29
72 0.29
73 0.26
74 0.2
75 0.18
76 0.18
77 0.17
78 0.16
79 0.14
80 0.11
81 0.08
82 0.07
83 0.06
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.04
93 0.04
94 0.03
95 0.04
96 0.03
97 0.03
98 0.04
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.07
105 0.08
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.05
114 0.06
115 0.06
116 0.05
117 0.04
118 0.04
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.09
126 0.09
127 0.08
128 0.09
129 0.09
130 0.08
131 0.08
132 0.09
133 0.07
134 0.09
135 0.09
136 0.09
137 0.11
138 0.12
139 0.11
140 0.11
141 0.12
142 0.12
143 0.13
144 0.18
145 0.17
146 0.23
147 0.25
148 0.3
149 0.3
150 0.29
151 0.29
152 0.26
153 0.24
154 0.2
155 0.22
156 0.18
157 0.18
158 0.18
159 0.17
160 0.14
161 0.15
162 0.15
163 0.13
164 0.13
165 0.13
166 0.15
167 0.22
168 0.3
169 0.36
170 0.45
171 0.53
172 0.6
173 0.7
174 0.77
175 0.81
176 0.83
177 0.87
178 0.88
179 0.9
180 0.93
181 0.92
182 0.89
183 0.81
184 0.79
185 0.78
186 0.76
187 0.75
188 0.72
189 0.67