Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3XQH3

Protein Details
Accession G3XQH3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-40NEQKSPKSPTSPKKMMRQKRDRRKKSLLRKAYEYSHydrophilic
NLS Segment(s)
PositionSequence
10-34SPKSPTSPKKMMRQKRDRRKKSLLR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MPKEPNEQKSPKSPTSPKKMMRQKRDRRKKSLLRKAYEYSKLCDADVCLGIRIRESGQVTTFLSDSTGFWSGLSSQLEIYYPRPTQKTEKDFDSNPTTDDDSAAAEDVKGGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.78
4 0.75
5 0.78
6 0.83
7 0.83
8 0.85
9 0.86
10 0.87
11 0.89
12 0.93
13 0.92
14 0.91
15 0.92
16 0.91
17 0.91
18 0.91
19 0.89
20 0.83
21 0.8
22 0.76
23 0.72
24 0.71
25 0.61
26 0.53
27 0.49
28 0.44
29 0.37
30 0.32
31 0.26
32 0.19
33 0.19
34 0.16
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.09
41 0.11
42 0.11
43 0.11
44 0.11
45 0.13
46 0.13
47 0.13
48 0.13
49 0.09
50 0.08
51 0.08
52 0.07
53 0.08
54 0.1
55 0.09
56 0.09
57 0.09
58 0.09
59 0.13
60 0.13
61 0.11
62 0.09
63 0.1
64 0.11
65 0.12
66 0.13
67 0.15
68 0.16
69 0.19
70 0.21
71 0.24
72 0.32
73 0.41
74 0.46
75 0.45
76 0.5
77 0.52
78 0.52
79 0.54
80 0.53
81 0.44
82 0.38
83 0.37
84 0.33
85 0.27
86 0.26
87 0.2
88 0.15
89 0.15
90 0.14
91 0.11
92 0.09
93 0.09