Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3XNW9

Protein Details
Accession G3XNW9    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-46HSESVGEKKRKPLRRDPEKRRQQNIQAQRRYRKCGSHBasic
48-68ESPHRRLASKREKLRERLGRLBasic
NLS Segment(s)
PositionSequence
17-42KKRKPLRRDPEKRRQQNIQAQRRYRK
48-64ESPHRRLASKREKLRER
Subcellular Location(s) nucl 18, cyto_nucl 12, cyto 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MPPQTRAIQHSESVGEKKRKPLRRDPEKRRQQNIQAQRRYRKCGSHLESPHRRLASKREKLRERLGRLEALAESAGQTPAIKSTPAAGIQPSGAITASGLPNTSSSIVPKTLPLYDASDVSVPSTSVATLGNCQQLIPASAESPSALYTSDSTITPYLYSDESPSALTVWDPPSCVDPSLLVSDKPSDSLELYWTTTIDCGCTSPHFRIQTECPDLLGHNEVRVFRFGTNTTTADPYTNSLRIDRVCTIAAILDLVRHVGVTEEALCADESLSPFFRPTAVMVDEAAKRNLIRTVQETFKSLKPDLRPFQEQITIEHHPMIDILPFRTLRRNLITRQHDIDEDEFFDDMLSGLVCWGGAGIGKRDRQVSTGYASTGTPWDVRSWEAKVWFLKKYWSLLGGEDGELVRQSEWWRSIRGDDIEQENMWLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.47
4 0.55
5 0.62
6 0.69
7 0.73
8 0.77
9 0.79
10 0.82
11 0.89
12 0.9
13 0.91
14 0.93
15 0.94
16 0.92
17 0.9
18 0.89
19 0.89
20 0.89
21 0.88
22 0.87
23 0.87
24 0.89
25 0.87
26 0.85
27 0.81
28 0.77
29 0.73
30 0.74
31 0.7
32 0.7
33 0.72
34 0.74
35 0.78
36 0.75
37 0.76
38 0.67
39 0.63
40 0.56
41 0.58
42 0.59
43 0.59
44 0.64
45 0.67
46 0.73
47 0.78
48 0.84
49 0.83
50 0.79
51 0.77
52 0.72
53 0.64
54 0.56
55 0.51
56 0.4
57 0.32
58 0.25
59 0.16
60 0.13
61 0.11
62 0.11
63 0.09
64 0.09
65 0.08
66 0.1
67 0.11
68 0.1
69 0.09
70 0.11
71 0.14
72 0.15
73 0.16
74 0.15
75 0.15
76 0.15
77 0.15
78 0.12
79 0.1
80 0.08
81 0.07
82 0.06
83 0.08
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.11
90 0.12
91 0.1
92 0.11
93 0.14
94 0.15
95 0.15
96 0.16
97 0.17
98 0.16
99 0.17
100 0.17
101 0.18
102 0.17
103 0.18
104 0.17
105 0.16
106 0.15
107 0.14
108 0.13
109 0.09
110 0.08
111 0.08
112 0.07
113 0.06
114 0.07
115 0.07
116 0.08
117 0.11
118 0.13
119 0.13
120 0.13
121 0.12
122 0.12
123 0.13
124 0.13
125 0.11
126 0.09
127 0.09
128 0.1
129 0.09
130 0.09
131 0.08
132 0.06
133 0.06
134 0.06
135 0.07
136 0.08
137 0.09
138 0.09
139 0.1
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.09
146 0.1
147 0.1
148 0.1
149 0.1
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.09
156 0.1
157 0.1
158 0.1
159 0.11
160 0.13
161 0.14
162 0.14
163 0.11
164 0.1
165 0.11
166 0.14
167 0.14
168 0.11
169 0.11
170 0.13
171 0.13
172 0.13
173 0.12
174 0.09
175 0.09
176 0.1
177 0.11
178 0.1
179 0.11
180 0.1
181 0.1
182 0.09
183 0.09
184 0.08
185 0.07
186 0.06
187 0.06
188 0.06
189 0.09
190 0.11
191 0.13
192 0.18
193 0.2
194 0.2
195 0.23
196 0.25
197 0.3
198 0.32
199 0.29
200 0.25
201 0.23
202 0.22
203 0.21
204 0.2
205 0.13
206 0.1
207 0.12
208 0.12
209 0.12
210 0.13
211 0.13
212 0.1
213 0.13
214 0.12
215 0.13
216 0.16
217 0.16
218 0.16
219 0.16
220 0.16
221 0.15
222 0.14
223 0.13
224 0.14
225 0.15
226 0.14
227 0.13
228 0.15
229 0.15
230 0.18
231 0.17
232 0.16
233 0.15
234 0.14
235 0.13
236 0.11
237 0.1
238 0.07
239 0.06
240 0.05
241 0.04
242 0.05
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.05
250 0.05
251 0.05
252 0.06
253 0.06
254 0.06
255 0.06
256 0.07
257 0.06
258 0.08
259 0.1
260 0.09
261 0.1
262 0.1
263 0.1
264 0.09
265 0.1
266 0.12
267 0.12
268 0.12
269 0.12
270 0.16
271 0.19
272 0.2
273 0.19
274 0.16
275 0.15
276 0.16
277 0.18
278 0.16
279 0.16
280 0.17
281 0.22
282 0.25
283 0.27
284 0.28
285 0.28
286 0.3
287 0.32
288 0.3
289 0.31
290 0.33
291 0.41
292 0.45
293 0.48
294 0.49
295 0.46
296 0.48
297 0.49
298 0.43
299 0.37
300 0.37
301 0.33
302 0.29
303 0.28
304 0.25
305 0.19
306 0.18
307 0.16
308 0.12
309 0.11
310 0.11
311 0.14
312 0.16
313 0.17
314 0.25
315 0.26
316 0.29
317 0.35
318 0.39
319 0.41
320 0.5
321 0.55
322 0.53
323 0.55
324 0.52
325 0.46
326 0.43
327 0.39
328 0.3
329 0.25
330 0.21
331 0.17
332 0.15
333 0.13
334 0.1
335 0.08
336 0.07
337 0.05
338 0.04
339 0.04
340 0.04
341 0.04
342 0.03
343 0.03
344 0.03
345 0.05
346 0.07
347 0.12
348 0.18
349 0.21
350 0.23
351 0.27
352 0.27
353 0.27
354 0.29
355 0.27
356 0.26
357 0.26
358 0.24
359 0.22
360 0.22
361 0.21
362 0.19
363 0.18
364 0.15
365 0.14
366 0.15
367 0.15
368 0.18
369 0.2
370 0.22
371 0.25
372 0.26
373 0.3
374 0.35
375 0.38
376 0.4
377 0.37
378 0.4
379 0.4
380 0.42
381 0.4
382 0.37
383 0.34
384 0.31
385 0.35
386 0.3
387 0.26
388 0.23
389 0.2
390 0.17
391 0.16
392 0.16
393 0.11
394 0.12
395 0.14
396 0.19
397 0.24
398 0.26
399 0.29
400 0.31
401 0.34
402 0.38
403 0.41
404 0.38
405 0.38
406 0.4
407 0.4
408 0.38