Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3Y4K1

Protein Details
Accession G3Y4K1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-52RDEGWRIGRKKGKRRVGEREKGGEBasic
NLS Segment(s)
PositionSequence
33-63WRIGRKKGKRRVGEREKGGEEDGEREKRKAR
Subcellular Location(s) cyto 10, cyto_nucl 8.5, mito 8, nucl 5, pero 4
Family & Domain DBs
Amino Acid Sequences MIGLGWQADWGSADVGRSNGLVAGTLERRDEGWRIGRKKGKRRVGEREKGGEEDGEREKRKARLVGWGATLGTLGEGKGNKPTQPAAMARKWANEREPPTSPWFQGGWPAGQSRVFITVFMHTPDSPIGPSACEDGTRQPPFPSWSVVTILIACPGKYPYPQRHGKADPFGGTNFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.09
6 0.09
7 0.09
8 0.08
9 0.08
10 0.12
11 0.14
12 0.15
13 0.15
14 0.14
15 0.15
16 0.17
17 0.19
18 0.19
19 0.26
20 0.34
21 0.37
22 0.45
23 0.52
24 0.59
25 0.68
26 0.73
27 0.74
28 0.75
29 0.8
30 0.83
31 0.86
32 0.86
33 0.82
34 0.78
35 0.71
36 0.63
37 0.54
38 0.44
39 0.34
40 0.29
41 0.28
42 0.28
43 0.27
44 0.27
45 0.31
46 0.33
47 0.37
48 0.37
49 0.32
50 0.35
51 0.37
52 0.38
53 0.35
54 0.33
55 0.28
56 0.23
57 0.22
58 0.12
59 0.08
60 0.06
61 0.04
62 0.05
63 0.06
64 0.06
65 0.12
66 0.13
67 0.13
68 0.14
69 0.15
70 0.14
71 0.17
72 0.21
73 0.21
74 0.22
75 0.25
76 0.24
77 0.27
78 0.29
79 0.28
80 0.28
81 0.28
82 0.3
83 0.31
84 0.33
85 0.32
86 0.35
87 0.35
88 0.31
89 0.28
90 0.25
91 0.2
92 0.23
93 0.21
94 0.17
95 0.16
96 0.16
97 0.15
98 0.15
99 0.15
100 0.11
101 0.13
102 0.12
103 0.11
104 0.11
105 0.12
106 0.13
107 0.14
108 0.15
109 0.12
110 0.13
111 0.13
112 0.13
113 0.11
114 0.12
115 0.11
116 0.09
117 0.1
118 0.11
119 0.11
120 0.11
121 0.12
122 0.16
123 0.25
124 0.27
125 0.28
126 0.27
127 0.3
128 0.33
129 0.33
130 0.32
131 0.25
132 0.25
133 0.26
134 0.25
135 0.23
136 0.2
137 0.18
138 0.19
139 0.17
140 0.15
141 0.14
142 0.16
143 0.17
144 0.22
145 0.31
146 0.35
147 0.44
148 0.53
149 0.56
150 0.62
151 0.68
152 0.69
153 0.69
154 0.65
155 0.59
156 0.53