Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3Y6Q1

Protein Details
Accession G3Y6Q1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-52RYAIRRTRTGWERKPKRNQTDNVNALHydrophilic
NLS Segment(s)
PositionSequence
76-96KGNESKARRKVKKGFEEKGPE
102-122APKEERAAPRAIRGSESRGGA
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MYSWNVGQKKEKRLSGGVKSNLAHIARYAIRRTRTGWERKPKRNQTDNVNALSHKRGGNTDNGMLQDRGKGMLGEKGNESKARRKVKKGFEEKGPEPFDDAAPKEERAAPRAIRGSESRGGASSAGKLSTAKKNATGKDRKVIVQFDGRWRDDPGSSISSSATTHFSLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.67
3 0.69
4 0.63
5 0.6
6 0.57
7 0.53
8 0.51
9 0.43
10 0.34
11 0.24
12 0.25
13 0.24
14 0.27
15 0.31
16 0.31
17 0.34
18 0.36
19 0.39
20 0.43
21 0.48
22 0.55
23 0.59
24 0.64
25 0.71
26 0.79
27 0.87
28 0.88
29 0.89
30 0.88
31 0.84
32 0.82
33 0.82
34 0.77
35 0.69
36 0.6
37 0.5
38 0.43
39 0.4
40 0.33
41 0.24
42 0.2
43 0.19
44 0.19
45 0.23
46 0.24
47 0.23
48 0.21
49 0.22
50 0.22
51 0.2
52 0.19
53 0.15
54 0.13
55 0.12
56 0.1
57 0.09
58 0.08
59 0.13
60 0.13
61 0.13
62 0.14
63 0.15
64 0.16
65 0.2
66 0.21
67 0.24
68 0.32
69 0.41
70 0.45
71 0.51
72 0.59
73 0.65
74 0.72
75 0.74
76 0.69
77 0.66
78 0.69
79 0.62
80 0.62
81 0.54
82 0.44
83 0.37
84 0.33
85 0.26
86 0.21
87 0.21
88 0.16
89 0.16
90 0.16
91 0.16
92 0.19
93 0.19
94 0.19
95 0.23
96 0.2
97 0.23
98 0.27
99 0.26
100 0.25
101 0.26
102 0.28
103 0.28
104 0.28
105 0.24
106 0.21
107 0.21
108 0.19
109 0.18
110 0.14
111 0.12
112 0.11
113 0.1
114 0.11
115 0.15
116 0.22
117 0.26
118 0.25
119 0.32
120 0.38
121 0.43
122 0.52
123 0.57
124 0.54
125 0.58
126 0.6
127 0.57
128 0.55
129 0.52
130 0.46
131 0.46
132 0.45
133 0.46
134 0.5
135 0.49
136 0.46
137 0.46
138 0.44
139 0.37
140 0.35
141 0.31
142 0.27
143 0.25
144 0.24
145 0.21
146 0.2
147 0.2
148 0.19
149 0.17
150 0.14