Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PPC1

Protein Details
Accession A0A1D8PPC1   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-85TFVGKVLIKNQQKQKSKKKAQHydrophilic
NLS Segment(s)
PositionSequence
81-83KKK
Subcellular Location(s) extr 7, cyto 6.5, cyto_nucl 4.5, mito 4, E.R. 4, plas 2, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0033185  C:dolichol-phosphate-mannose synthase complex  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0006488  P:dolichol-linked oligosaccharide biosynthetic process  
GO:0009272  P:fungal-type cell wall biogenesis  
GO:0006506  P:GPI anchor biosynthetic process  
GO:0006487  P:protein N-linked glycosylation  
GO:0006493  P:protein O-linked glycosylation  
KEGG cal:CAALFM_C600420WA  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MGADKLIGFGMLGVAAFVFTYYTAWVFVLPFINEDNILNQFFLPRDYAIKLPILLLFIAALGVGTFVGKVLIKNQQKQKSKKKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.06
14 0.07
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.08
28 0.08
29 0.09
30 0.08
31 0.07
32 0.08
33 0.1
34 0.1
35 0.11
36 0.11
37 0.11
38 0.1
39 0.1
40 0.1
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.04
55 0.05
56 0.05
57 0.09
58 0.19
59 0.26
60 0.34
61 0.44
62 0.53
63 0.63
64 0.73
65 0.81