Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3Y321

Protein Details
Accession G3Y321   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LLWKIPWRLSQPQKARQRKRLRGVDRVVHydrophilic
73-102DKYTLFDKKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
80-94KKEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPSSPLFSGLLWKIPWRLSQPQKARQRKRLRGVDRVVDTVSAALERNGYTTKAVERWYREMPREEEMLPKDKYTLFDKKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.28
5 0.28
6 0.37
7 0.42
8 0.51
9 0.58
10 0.65
11 0.73
12 0.8
13 0.84
14 0.85
15 0.87
16 0.87
17 0.88
18 0.89
19 0.85
20 0.83
21 0.79
22 0.76
23 0.67
24 0.59
25 0.49
26 0.38
27 0.31
28 0.22
29 0.16
30 0.09
31 0.07
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.11
42 0.14
43 0.16
44 0.18
45 0.23
46 0.29
47 0.32
48 0.34
49 0.36
50 0.36
51 0.35
52 0.34
53 0.3
54 0.29
55 0.29
56 0.31
57 0.27
58 0.25
59 0.24
60 0.23
61 0.25
62 0.26
63 0.32
64 0.3
65 0.39
66 0.47
67 0.55
68 0.64
69 0.7
70 0.71
71 0.73
72 0.79
73 0.8
74 0.84
75 0.85
76 0.86
77 0.85
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79