Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3XMQ6

Protein Details
Accession G3XMQ6   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
125-150EEVRDKSYPRCYCKKPKLPFSRVAGLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.332, cyto_nucl 10.166, mito 10, cyto_mito 9.832, nucl 9, cyto 8
Family & Domain DBs
Amino Acid Sequences MDKAARSYNTPVVPVKWEFADSCAKKVSYASRYEDQPDGEVVQIVCLFNLGCNPSGDSVLAGEEKAAVQQDKPGGMVQEKTRRGRWVRKRDLGDSWPSVHARLSSALWGKGAITYDIVTSFRKEEEVRDKSYPRCYCKKPKLPFSRVAGLEVPQEGVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.25
4 0.25
5 0.22
6 0.23
7 0.31
8 0.28
9 0.29
10 0.31
11 0.29
12 0.28
13 0.31
14 0.36
15 0.31
16 0.35
17 0.38
18 0.39
19 0.41
20 0.44
21 0.43
22 0.35
23 0.31
24 0.27
25 0.21
26 0.17
27 0.16
28 0.13
29 0.11
30 0.11
31 0.1
32 0.08
33 0.08
34 0.07
35 0.06
36 0.08
37 0.08
38 0.08
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.09
45 0.07
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.08
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.1
63 0.12
64 0.15
65 0.22
66 0.27
67 0.29
68 0.31
69 0.36
70 0.41
71 0.49
72 0.55
73 0.58
74 0.63
75 0.68
76 0.7
77 0.67
78 0.66
79 0.6
80 0.54
81 0.46
82 0.38
83 0.33
84 0.29
85 0.26
86 0.22
87 0.18
88 0.14
89 0.14
90 0.12
91 0.13
92 0.15
93 0.15
94 0.15
95 0.14
96 0.13
97 0.13
98 0.13
99 0.09
100 0.08
101 0.08
102 0.08
103 0.09
104 0.11
105 0.1
106 0.11
107 0.12
108 0.11
109 0.14
110 0.14
111 0.2
112 0.29
113 0.33
114 0.37
115 0.42
116 0.46
117 0.48
118 0.58
119 0.58
120 0.56
121 0.6
122 0.64
123 0.69
124 0.76
125 0.82
126 0.82
127 0.85
128 0.88
129 0.87
130 0.86
131 0.82
132 0.8
133 0.71
134 0.64
135 0.55
136 0.46
137 0.41
138 0.33