Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3Y4N2

Protein Details
Accession G3Y4N2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-74VCLMPRRQGKRKRWIANRLINRIHydrophilic
NLS Segment(s)
PositionSequence
60-63GKRK
Subcellular Location(s) plas 19, vacu 5, mito 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences SVVISVFAIVILSVLGSLYKSEHPGFTGSEGEPEDGAAVAASIFTAVLVYIVCLMPRRQGKRKRWIANRLINRIGFLRVLRFPGVLAHEGPEGRRYIVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.06
6 0.08
7 0.12
8 0.13
9 0.13
10 0.15
11 0.16
12 0.17
13 0.16
14 0.18
15 0.14
16 0.16
17 0.16
18 0.15
19 0.13
20 0.12
21 0.1
22 0.07
23 0.07
24 0.04
25 0.03
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.04
40 0.05
41 0.05
42 0.11
43 0.18
44 0.25
45 0.33
46 0.43
47 0.53
48 0.62
49 0.72
50 0.77
51 0.8
52 0.83
53 0.84
54 0.84
55 0.84
56 0.79
57 0.74
58 0.64
59 0.56
60 0.47
61 0.39
62 0.31
63 0.23
64 0.21
65 0.18
66 0.2
67 0.2
68 0.19
69 0.17
70 0.18
71 0.21
72 0.19
73 0.18
74 0.17
75 0.19
76 0.19
77 0.2
78 0.2
79 0.18