Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3XQH1

Protein Details
Accession G3XQH1   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-35AARPRRIQKRFSDSPKSKRQQQSRRKDNLFFKSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAARPRRIQKRFSDSPKSKRQQQSRRKDNLFFKSFEYCHECDADIFIMVRNKKTGQILFFNSDSNWPPSVEELVQYSPIKILRASYYPKPKQVTWKELAARY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.85
4 0.82
5 0.82
6 0.82
7 0.84
8 0.84
9 0.85
10 0.87
11 0.86
12 0.9
13 0.85
14 0.83
15 0.82
16 0.8
17 0.74
18 0.64
19 0.56
20 0.52
21 0.47
22 0.42
23 0.39
24 0.3
25 0.27
26 0.27
27 0.24
28 0.18
29 0.19
30 0.15
31 0.09
32 0.08
33 0.08
34 0.12
35 0.12
36 0.13
37 0.13
38 0.13
39 0.15
40 0.18
41 0.19
42 0.17
43 0.21
44 0.24
45 0.26
46 0.26
47 0.24
48 0.21
49 0.21
50 0.21
51 0.19
52 0.17
53 0.14
54 0.14
55 0.14
56 0.16
57 0.14
58 0.13
59 0.13
60 0.13
61 0.17
62 0.17
63 0.16
64 0.16
65 0.17
66 0.17
67 0.15
68 0.16
69 0.15
70 0.21
71 0.26
72 0.33
73 0.43
74 0.47
75 0.54
76 0.57
77 0.57
78 0.63
79 0.67
80 0.67
81 0.6
82 0.64