Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TQR1

Protein Details
Accession A7TQR1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HTAHNQTKKAHRNGIKKPKTBasic
NLS Segment(s)
PositionSequence
14-63KKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAKRAAAKN
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vpo:Kpol_1063p17  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTKKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAKRAAAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.75
4 0.73
5 0.72
6 0.75
7 0.81
8 0.8
9 0.78
10 0.79
11 0.77
12 0.77
13 0.75
14 0.74
15 0.72
16 0.7
17 0.69
18 0.64
19 0.6
20 0.59
21 0.58
22 0.58
23 0.53
24 0.55
25 0.57
26 0.62
27 0.67
28 0.65
29 0.69
30 0.64
31 0.7
32 0.67
33 0.67
34 0.64
35 0.59
36 0.54
37 0.47
38 0.42
39 0.35
40 0.31
41 0.25
42 0.21
43 0.22