Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HBD3

Protein Details
Accession Q2HBD3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40LAARILRRPTPPRQPPLRNPLPPKTRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018811  Mrx11  
Pfam View protein in Pfam  
PF10306  FLILHELTA  
Amino Acid Sequences MPPLPPLPLQFPSLAARILRRPTPPRQPPLRNPLPPKTRTTKRHPYSSSSTNPPAPPPPPNPNPNPTHQKTTRLHRILTRLPRPLQHYTARLRGAPATHVVAFLLLHELTAVVPLAGLFALFHYTEQVPVAWMVAHYGGYVREGVGRFERWFWRRGWFGFGDAGDAGVTDGEGGQGEGEGEGGGKGEGEGEGGGKGVVGADAVLSRWEADPKYRILVEVGLAYALTKVLLPVRIVASVWATPWFAGVLGRLRRVVRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.24
4 0.28
5 0.33
6 0.35
7 0.4
8 0.45
9 0.52
10 0.62
11 0.67
12 0.7
13 0.75
14 0.81
15 0.82
16 0.85
17 0.86
18 0.84
19 0.82
20 0.83
21 0.81
22 0.75
23 0.73
24 0.73
25 0.73
26 0.72
27 0.74
28 0.75
29 0.73
30 0.79
31 0.75
32 0.73
33 0.71
34 0.71
35 0.68
36 0.64
37 0.61
38 0.56
39 0.54
40 0.5
41 0.47
42 0.42
43 0.43
44 0.42
45 0.46
46 0.49
47 0.54
48 0.56
49 0.58
50 0.59
51 0.6
52 0.63
53 0.58
54 0.6
55 0.56
56 0.6
57 0.58
58 0.64
59 0.67
60 0.61
61 0.59
62 0.55
63 0.59
64 0.58
65 0.62
66 0.59
67 0.55
68 0.53
69 0.55
70 0.56
71 0.54
72 0.51
73 0.46
74 0.45
75 0.43
76 0.47
77 0.44
78 0.39
79 0.35
80 0.31
81 0.27
82 0.22
83 0.2
84 0.16
85 0.14
86 0.14
87 0.12
88 0.11
89 0.1
90 0.08
91 0.08
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.02
106 0.02
107 0.04
108 0.04
109 0.04
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.07
130 0.08
131 0.09
132 0.11
133 0.12
134 0.12
135 0.15
136 0.22
137 0.22
138 0.24
139 0.24
140 0.28
141 0.29
142 0.3
143 0.31
144 0.25
145 0.25
146 0.24
147 0.23
148 0.19
149 0.15
150 0.14
151 0.09
152 0.08
153 0.06
154 0.04
155 0.04
156 0.03
157 0.03
158 0.02
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.04
192 0.06
193 0.07
194 0.1
195 0.11
196 0.15
197 0.18
198 0.2
199 0.24
200 0.23
201 0.23
202 0.21
203 0.21
204 0.18
205 0.16
206 0.14
207 0.1
208 0.09
209 0.09
210 0.07
211 0.06
212 0.05
213 0.04
214 0.05
215 0.08
216 0.1
217 0.11
218 0.13
219 0.15
220 0.16
221 0.16
222 0.16
223 0.16
224 0.14
225 0.15
226 0.14
227 0.13
228 0.12
229 0.13
230 0.12
231 0.09
232 0.09
233 0.11
234 0.18
235 0.22
236 0.25
237 0.29
238 0.32