Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3YCW9

Protein Details
Accession G3YCW9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-101DDTPKPKNKARKEADRGGRGBasic
NLS Segment(s)
PositionSequence
86-121KPKNKARKEADRGGRGGRGGPRGRGRGRGRGRGRGF
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0003723  F:RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLVRFLMKCANETVTIELKNGTILHGTITSVSPQMNTSLRTVKMTPKGRDPISLDTINIRGSTIRYYILPDSLPLDTLLIDDTPKPKNKARKEADRGGRGGRGGPRGRGRGRGRGRGRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.25
4 0.24
5 0.21
6 0.19
7 0.19
8 0.17
9 0.14
10 0.1
11 0.09
12 0.1
13 0.1
14 0.1
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.12
23 0.13
24 0.14
25 0.15
26 0.19
27 0.2
28 0.22
29 0.23
30 0.26
31 0.33
32 0.4
33 0.4
34 0.42
35 0.47
36 0.45
37 0.48
38 0.45
39 0.41
40 0.38
41 0.36
42 0.29
43 0.24
44 0.24
45 0.21
46 0.17
47 0.12
48 0.07
49 0.08
50 0.09
51 0.08
52 0.08
53 0.08
54 0.1
55 0.11
56 0.11
57 0.11
58 0.1
59 0.11
60 0.1
61 0.11
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.05
68 0.06
69 0.07
70 0.1
71 0.15
72 0.2
73 0.25
74 0.3
75 0.4
76 0.49
77 0.59
78 0.64
79 0.7
80 0.74
81 0.79
82 0.82
83 0.78
84 0.72
85 0.64
86 0.58
87 0.48
88 0.44
89 0.39
90 0.38
91 0.36
92 0.41
93 0.45
94 0.51
95 0.53
96 0.59
97 0.6
98 0.61
99 0.67
100 0.7
101 0.7