FuNGI

G3XN58

Protein Details

Accession

G3XN58

Localization Confidence

Medium

Confidence Score

12.8

NoLS Segment(s)

Position	Sequence	Protein Nature
81-109	RTSETRPLPEGKRPRKKRVREGGICNFQI	Hydrophilic

NLS Segment(s)

Position	Sequence
86-100	RPLPEGKRPRKKRVR

Subcellular Location(s)

nucl 12, mito 10, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR024072 DHFR-like_dom_sf IPR002734 RibDG_C
Gene Ontology	GO:0008703 F:5-amino-6-(5-phosphoribosylamino)uracil reductase activity GO:0009231 P:riboflavin biosynthetic process
Pfam	View protein in Pfam PF01872 RibD_C

Amino Acid Sequences

SRSRDSSSATNHNLINNPPNLARIRQVMFECKDPIEISLEEFETYWPFIDNVWVKQRSNSSKEGHCTTDYYMCRLRRPTHRTSETRPLPEGKRPRKKRVREGGICNFQIKVVKFEGAYSTVTIARTPGSSQVHSHDLDYIDRVKRNSGLMEFARREAIKGYLPSSIFTKFQEEPEKLIEAGGKFCTVTDVRNVSAKWRIQNPDVKLVAHEGYEYHKGHGIVRMRAADGISNTPGDKLLSNAAIHSSLPPDTLSFPQFPLEFLEPYLPKHNDRRQFPHVTLSYASSMDSKISLLPGMQTVLSGPEAKLMTHYLRSRHDAILIGVGTVLADNPGLNCRLEGAGGFGGLGRMWQPRPVVVDPTGRWPVHPDCRMLRTAVEGKGKAPWVVVSPGARIDPQKLMMLKGYGGDYLRIMEYNQNWRLRWEAILRALASEGIKSVMIEGGGTVLSELLNPEYTEFIDTIIVTVAPTYLGSGGVSVSPDSKRDQEGKPNAALNPRDVKWTPLGQNVIMCGRIRVAP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.46
3	0.39
4	0.37
5	0.33
6	0.36
7	0.35
8	0.34
9	0.34
10	0.33
11	0.33
12	0.35
13	0.38
14	0.42
15	0.41
16	0.44
17	0.42
18	0.37
19	0.37
20	0.32
21	0.3
22	0.25
23	0.23
24	0.21
25	0.21
26	0.2
27	0.18
28	0.18
29	0.17
30	0.15
31	0.15
32	0.13
33	0.11
34	0.1
35	0.1
36	0.18
37	0.21
38	0.25
39	0.34
40	0.38
41	0.38
42	0.42
43	0.52
44	0.52
45	0.54
46	0.55
47	0.52
48	0.54
49	0.6
50	0.59
51	0.54
52	0.47
53	0.44
54	0.4
55	0.43
56	0.37
57	0.36
58	0.39
59	0.38
60	0.43
61	0.47
62	0.52
63	0.54
64	0.6
65	0.64
66	0.68
67	0.74
68	0.75
69	0.76
70	0.79
71	0.77
72	0.74
73	0.69
74	0.65
75	0.6
76	0.62
77	0.65
78	0.65
79	0.68
80	0.73
81	0.8
82	0.84
83	0.89
84	0.91
85	0.91
86	0.91
87	0.89
88	0.9
89	0.89
90	0.87
91	0.78
92	0.68
93	0.57
94	0.47
95	0.43
96	0.34
97	0.28
98	0.21
99	0.21
100	0.2
101	0.21
102	0.22
103	0.19
104	0.19
105	0.15
106	0.15
107	0.15
108	0.15
109	0.14
110	0.12
111	0.11
112	0.11
113	0.11
114	0.16
115	0.18
116	0.19
117	0.21
118	0.24
119	0.28
120	0.27
121	0.27
122	0.23
123	0.21
124	0.2
125	0.21
126	0.23
127	0.23
128	0.25
129	0.25
130	0.24
131	0.25
132	0.26
133	0.27
134	0.22
135	0.24
136	0.24
137	0.31
138	0.3
139	0.28
140	0.31
141	0.28
142	0.27
143	0.23
144	0.22
145	0.18
146	0.19
147	0.19
148	0.19
149	0.19
150	0.2
151	0.2
152	0.2
153	0.17
154	0.17
155	0.21
156	0.18
157	0.23
158	0.29
159	0.28
160	0.29
161	0.3
162	0.31
163	0.25
164	0.24
165	0.22
166	0.15
167	0.16
168	0.14
169	0.12
170	0.1
171	0.1
172	0.13
173	0.11
174	0.11
175	0.14
176	0.16
177	0.16
178	0.2
179	0.2
180	0.2
181	0.26
182	0.28
183	0.27
184	0.31
185	0.34
186	0.36
187	0.43
188	0.43
189	0.44
190	0.43
191	0.39
192	0.33
193	0.31
194	0.27
195	0.2
196	0.17
197	0.09
198	0.11
199	0.17
200	0.17
201	0.15
202	0.17
203	0.18
204	0.19
205	0.24
206	0.25
207	0.21
208	0.22
209	0.22
210	0.2
211	0.2
212	0.19
213	0.15
214	0.12
215	0.12
216	0.1
217	0.1
218	0.1
219	0.09
220	0.1
221	0.09
222	0.08
223	0.07
224	0.08
225	0.09
226	0.09
227	0.09
228	0.09
229	0.09
230	0.09
231	0.08
232	0.08
233	0.07
234	0.07
235	0.07
236	0.07
237	0.08
238	0.1
239	0.12
240	0.11
241	0.12
242	0.13
243	0.13
244	0.12
245	0.14
246	0.14
247	0.12
248	0.11
249	0.14
250	0.13
251	0.15
252	0.21
253	0.19
254	0.2
255	0.29
256	0.35
257	0.39
258	0.44
259	0.5
260	0.51
261	0.54
262	0.52
263	0.52
264	0.45
265	0.4
266	0.36
267	0.3
268	0.24
269	0.19
270	0.19
271	0.11
272	0.11
273	0.09
274	0.08
275	0.07
276	0.06
277	0.06
278	0.06
279	0.05
280	0.05
281	0.06
282	0.06
283	0.06
284	0.05
285	0.05
286	0.06
287	0.07
288	0.07
289	0.06
290	0.09
291	0.1
292	0.1
293	0.11
294	0.12
295	0.13
296	0.18
297	0.2
298	0.21
299	0.24
300	0.28
301	0.3
302	0.29
303	0.29
304	0.24
305	0.22
306	0.21
307	0.18
308	0.14
309	0.1
310	0.09
311	0.08
312	0.06
313	0.06
314	0.03
315	0.03
316	0.03
317	0.03
318	0.05
319	0.06
320	0.06
321	0.06
322	0.07
323	0.07
324	0.08
325	0.07
326	0.08
327	0.07
328	0.07
329	0.07
330	0.06
331	0.06
332	0.06
333	0.06
334	0.05
335	0.08
336	0.09
337	0.12
338	0.12
339	0.14
340	0.19
341	0.21
342	0.23
343	0.23
344	0.29
345	0.27
346	0.33
347	0.38
348	0.33
349	0.31
350	0.33
351	0.36
352	0.39
353	0.41
354	0.39
355	0.37
356	0.41
357	0.42
358	0.38
359	0.31
360	0.28
361	0.31
362	0.32
363	0.33
364	0.3
365	0.29
366	0.32
367	0.33
368	0.27
369	0.23
370	0.18
371	0.15
372	0.16
373	0.18
374	0.15
375	0.15
376	0.16
377	0.17
378	0.17
379	0.16
380	0.17
381	0.17
382	0.18
383	0.22
384	0.21
385	0.22
386	0.22
387	0.22
388	0.19
389	0.17
390	0.16
391	0.14
392	0.13
393	0.13
394	0.11
395	0.11
396	0.12
397	0.1
398	0.11
399	0.14
400	0.18
401	0.27
402	0.33
403	0.36
404	0.36
405	0.37
406	0.4
407	0.36
408	0.36
409	0.31
410	0.3
411	0.3
412	0.33
413	0.32
414	0.29
415	0.27
416	0.25
417	0.21
418	0.15
419	0.12
420	0.09
421	0.09
422	0.08
423	0.09
424	0.08
425	0.07
426	0.07
427	0.06
428	0.06
429	0.06
430	0.06
431	0.05
432	0.04
433	0.04
434	0.05
435	0.06
436	0.06
437	0.08
438	0.08
439	0.09
440	0.1
441	0.1
442	0.12
443	0.11
444	0.1
445	0.1
446	0.1
447	0.1
448	0.09
449	0.08
450	0.07
451	0.07
452	0.06
453	0.05
454	0.05
455	0.06
456	0.05
457	0.06
458	0.06
459	0.06
460	0.07
461	0.07
462	0.08
463	0.08
464	0.11
465	0.12
466	0.14
467	0.18
468	0.21
469	0.26
470	0.32
471	0.37
472	0.45
473	0.53
474	0.56
475	0.57
476	0.58
477	0.55
478	0.57
479	0.53
480	0.49
481	0.48
482	0.43
483	0.45
484	0.42
485	0.43
486	0.41
487	0.47
488	0.45
489	0.44
490	0.47
491	0.41
492	0.42
493	0.41
494	0.37
495	0.32
496	0.28
497	0.22

G3XN58

3D AlphaFold-predicted Structure Viewer