Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H699

Protein Details
Accession Q2H699    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-47VDARGGRVRRRARDRRDRFISLBasic
NLS Segment(s)
PositionSequence
31-41GRVRRRARDRR
Subcellular Location(s) nucl 10, cyto 6.5, mito 5, cysk 5, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MSVSCLDMLTAQRSNMPHSFLDINDVDARGGRVRRRARDRRDRFISLSEKMTGLVPRTEYRFSDDWLGGLQRGDVAGRPHGKENCTLSPTMGVEGGPLSCTVTCRAKERTNRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.22
5 0.24
6 0.26
7 0.22
8 0.26
9 0.21
10 0.22
11 0.2
12 0.2
13 0.16
14 0.15
15 0.16
16 0.15
17 0.18
18 0.19
19 0.27
20 0.34
21 0.43
22 0.54
23 0.62
24 0.69
25 0.76
26 0.81
27 0.82
28 0.82
29 0.77
30 0.68
31 0.65
32 0.59
33 0.5
34 0.44
35 0.35
36 0.27
37 0.24
38 0.23
39 0.17
40 0.14
41 0.12
42 0.12
43 0.12
44 0.15
45 0.16
46 0.15
47 0.19
48 0.18
49 0.18
50 0.2
51 0.19
52 0.16
53 0.16
54 0.16
55 0.11
56 0.1
57 0.09
58 0.05
59 0.06
60 0.06
61 0.07
62 0.08
63 0.13
64 0.17
65 0.18
66 0.24
67 0.27
68 0.28
69 0.31
70 0.35
71 0.35
72 0.34
73 0.33
74 0.28
75 0.28
76 0.27
77 0.23
78 0.18
79 0.12
80 0.1
81 0.11
82 0.1
83 0.08
84 0.07
85 0.08
86 0.08
87 0.09
88 0.13
89 0.19
90 0.22
91 0.27
92 0.35
93 0.42
94 0.52