Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0R925

Protein Details
Accession G0R925    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-78RDQRDEPVIKHKRRKRRQAGEEDDSABasic
NLS Segment(s)
PositionSequence
44-69RRSSISKPGRDQRDEPVIKHKRRKRR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
KEGG tre:TRIREDRAFT_103028  -  
Amino Acid Sequences MAPPSPTGARDSAGSSASEKQRSSKKRGYSDTTGLNGDKRHVVRRSSISKPGRDQRDEPVIKHKRRKRRQAGEEDDSAIAEAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.22
4 0.26
5 0.29
6 0.27
7 0.31
8 0.39
9 0.45
10 0.51
11 0.52
12 0.56
13 0.6
14 0.67
15 0.68
16 0.65
17 0.63
18 0.58
19 0.52
20 0.46
21 0.37
22 0.33
23 0.26
24 0.21
25 0.21
26 0.18
27 0.22
28 0.24
29 0.25
30 0.27
31 0.33
32 0.38
33 0.38
34 0.46
35 0.45
36 0.46
37 0.51
38 0.55
39 0.56
40 0.54
41 0.52
42 0.49
43 0.55
44 0.52
45 0.47
46 0.5
47 0.52
48 0.57
49 0.65
50 0.67
51 0.68
52 0.76
53 0.86
54 0.86
55 0.88
56 0.9
57 0.91
58 0.92
59 0.87
60 0.79
61 0.71
62 0.6
63 0.49
64 0.38