Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0R7H5

Protein Details
Accession G0R7H5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
272-296KTTPISRRRPYKPRTARRRAQSLKAHydrophilic
NLS Segment(s)
PositionSequence
278-290RRRPYKPRTARRR
Subcellular Location(s) cyto 15, nucl 8, cyto_pero 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002562  3'-5'_exonuclease_dom  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0008408  F:3'-5' exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
KEGG tre:TRIREDRAFT_52956  -  
Pfam View protein in Pfam  
PF01612  DNA_pol_A_exo1  
CDD cd06141  WRN_exo  
Amino Acid Sequences EEFLAARAAVPGTSQSHWSHTMYHRAGENGAVDNVKVHYCESKATAERVCKEYFLNEDVLGFDLEWMKYATRTDGPRQNVSLIQIASPSRIALIHVALFAKEDGDLVAPSLRKILENPNVSKVGVNIGGDCTRLKNYLGITVRGVFELSHLYKVVKYLPEKPSMVNKGLVSLATQVEDHLLLPLYKGLVVRTGNWMRRLNPQQIHYSASDAYAGLQLYYVLEEKRKAIVPCPPRPHHAELRLPIPLPEPPVVEAQASEDGSTVDPSTTSTDKTTPISRRRPYKPRTARRRAQSLKASASELGASETSVMGDAASESLEANLKPEDTRDARIIEAEAQMKEYRSSKGNKLETTAARLRAYYIWHQNEDLCPSDIAALLRDPPLLTATVVGYVIDAIQAEKLPYPAIRMHKEIVSLIDLTKPYMYKYSTLVRECTEAAEKMMKEQQAEAADTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.25
4 0.29
5 0.3
6 0.33
7 0.35
8 0.44
9 0.41
10 0.43
11 0.41
12 0.39
13 0.38
14 0.33
15 0.31
16 0.23
17 0.23
18 0.2
19 0.17
20 0.17
21 0.18
22 0.17
23 0.15
24 0.14
25 0.16
26 0.16
27 0.19
28 0.21
29 0.27
30 0.3
31 0.34
32 0.38
33 0.41
34 0.45
35 0.46
36 0.44
37 0.38
38 0.36
39 0.35
40 0.33
41 0.29
42 0.26
43 0.21
44 0.21
45 0.2
46 0.2
47 0.17
48 0.12
49 0.11
50 0.11
51 0.11
52 0.11
53 0.12
54 0.11
55 0.12
56 0.13
57 0.16
58 0.19
59 0.25
60 0.32
61 0.39
62 0.44
63 0.47
64 0.48
65 0.47
66 0.43
67 0.4
68 0.37
69 0.29
70 0.24
71 0.22
72 0.21
73 0.2
74 0.18
75 0.15
76 0.11
77 0.1
78 0.11
79 0.1
80 0.11
81 0.1
82 0.11
83 0.12
84 0.11
85 0.12
86 0.11
87 0.09
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.1
95 0.1
96 0.1
97 0.12
98 0.12
99 0.11
100 0.14
101 0.22
102 0.27
103 0.34
104 0.36
105 0.39
106 0.4
107 0.4
108 0.38
109 0.29
110 0.24
111 0.19
112 0.17
113 0.12
114 0.13
115 0.14
116 0.14
117 0.14
118 0.13
119 0.12
120 0.13
121 0.14
122 0.14
123 0.14
124 0.21
125 0.23
126 0.23
127 0.23
128 0.23
129 0.23
130 0.21
131 0.2
132 0.12
133 0.1
134 0.14
135 0.14
136 0.13
137 0.13
138 0.14
139 0.14
140 0.15
141 0.18
142 0.17
143 0.19
144 0.27
145 0.31
146 0.36
147 0.36
148 0.37
149 0.42
150 0.41
151 0.4
152 0.35
153 0.3
154 0.27
155 0.26
156 0.24
157 0.16
158 0.14
159 0.12
160 0.09
161 0.09
162 0.07
163 0.08
164 0.08
165 0.07
166 0.06
167 0.06
168 0.05
169 0.05
170 0.06
171 0.05
172 0.06
173 0.06
174 0.06
175 0.1
176 0.11
177 0.11
178 0.19
179 0.24
180 0.26
181 0.32
182 0.34
183 0.32
184 0.41
185 0.45
186 0.45
187 0.44
188 0.44
189 0.42
190 0.42
191 0.42
192 0.34
193 0.3
194 0.22
195 0.18
196 0.16
197 0.11
198 0.1
199 0.08
200 0.08
201 0.06
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.05
208 0.06
209 0.07
210 0.08
211 0.1
212 0.14
213 0.14
214 0.15
215 0.23
216 0.3
217 0.37
218 0.45
219 0.45
220 0.45
221 0.5
222 0.53
223 0.52
224 0.51
225 0.48
226 0.42
227 0.42
228 0.4
229 0.35
230 0.3
231 0.24
232 0.18
233 0.16
234 0.15
235 0.13
236 0.12
237 0.14
238 0.14
239 0.12
240 0.11
241 0.1
242 0.11
243 0.11
244 0.09
245 0.08
246 0.08
247 0.08
248 0.09
249 0.07
250 0.05
251 0.05
252 0.06
253 0.09
254 0.09
255 0.1
256 0.12
257 0.13
258 0.15
259 0.17
260 0.23
261 0.28
262 0.37
263 0.45
264 0.5
265 0.58
266 0.66
267 0.73
268 0.72
269 0.75
270 0.77
271 0.78
272 0.83
273 0.84
274 0.83
275 0.81
276 0.87
277 0.81
278 0.78
279 0.75
280 0.7
281 0.64
282 0.57
283 0.51
284 0.4
285 0.35
286 0.27
287 0.19
288 0.14
289 0.1
290 0.08
291 0.07
292 0.06
293 0.06
294 0.05
295 0.05
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.06
305 0.06
306 0.07
307 0.08
308 0.08
309 0.08
310 0.09
311 0.16
312 0.17
313 0.2
314 0.21
315 0.22
316 0.22
317 0.23
318 0.23
319 0.18
320 0.19
321 0.19
322 0.17
323 0.18
324 0.19
325 0.19
326 0.2
327 0.2
328 0.19
329 0.22
330 0.27
331 0.32
332 0.41
333 0.46
334 0.45
335 0.47
336 0.51
337 0.48
338 0.5
339 0.48
340 0.43
341 0.37
342 0.36
343 0.34
344 0.29
345 0.31
346 0.31
347 0.35
348 0.36
349 0.37
350 0.38
351 0.38
352 0.39
353 0.38
354 0.33
355 0.25
356 0.2
357 0.19
358 0.18
359 0.18
360 0.16
361 0.14
362 0.12
363 0.12
364 0.13
365 0.13
366 0.12
367 0.11
368 0.12
369 0.11
370 0.1
371 0.1
372 0.09
373 0.1
374 0.1
375 0.09
376 0.08
377 0.07
378 0.07
379 0.06
380 0.05
381 0.05
382 0.06
383 0.07
384 0.08
385 0.09
386 0.09
387 0.11
388 0.11
389 0.14
390 0.2
391 0.27
392 0.31
393 0.34
394 0.37
395 0.37
396 0.38
397 0.36
398 0.32
399 0.27
400 0.23
401 0.19
402 0.21
403 0.19
404 0.19
405 0.21
406 0.19
407 0.18
408 0.23
409 0.24
410 0.21
411 0.26
412 0.34
413 0.39
414 0.42
415 0.43
416 0.4
417 0.41
418 0.39
419 0.39
420 0.35
421 0.27
422 0.27
423 0.31
424 0.29
425 0.31
426 0.36
427 0.34
428 0.31
429 0.31
430 0.33
431 0.3