Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0REC3

Protein Details
Accession G0REC3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-82DQTRQRRQQERAKRKTPQHKYSDMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027925  MCM_N  
KEGG tre:TRIREDRAFT_105676  -  
Pfam View protein in Pfam  
PF14551  MCM_N  
Amino Acid Sequences MALREFKAPVNYETQQSAFESFLKDFKTSPEHTLTTALGNITIDEDDLSDEDDLMDEDDQTRQRRQQERAKRKTPQHKYSDMLQLLADRKIDEFPIDLDDLAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.25
4 0.24
5 0.18
6 0.17
7 0.18
8 0.16
9 0.18
10 0.18
11 0.18
12 0.16
13 0.19
14 0.24
15 0.24
16 0.27
17 0.29
18 0.28
19 0.28
20 0.29
21 0.27
22 0.21
23 0.19
24 0.15
25 0.1
26 0.09
27 0.08
28 0.07
29 0.06
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.04
45 0.06
46 0.1
47 0.13
48 0.15
49 0.19
50 0.27
51 0.35
52 0.42
53 0.5
54 0.58
55 0.67
56 0.75
57 0.79
58 0.79
59 0.82
60 0.86
61 0.86
62 0.85
63 0.81
64 0.77
65 0.72
66 0.69
67 0.69
68 0.58
69 0.48
70 0.39
71 0.36
72 0.32
73 0.31
74 0.25
75 0.16
76 0.16
77 0.17
78 0.17
79 0.14
80 0.13
81 0.13
82 0.16
83 0.16