Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RQX2

Protein Details
Accession G0RQX2   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-79PTSGPRKAISKKKARKLEKKMGYELKRBasic
NLS Segment(s)
PositionSequence
11-79SKNRQAARAAKARKANLKRCNPANQDKVAKADRTRGARPGLLPTSGPRKAISKKKARKLEKKMGYELKR
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
KEGG tre:TRIREDRAFT_43242  -  
Amino Acid Sequences MANVKNPNRISKNRQAARAAKARKANLKRCNPANQDKVAKADRTRGARPGLLPTSGPRKAISKKKARKLEKKMGYELKRRMEAEGEAVMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.7
4 0.69
5 0.69
6 0.64
7 0.59
8 0.6
9 0.59
10 0.62
11 0.65
12 0.67
13 0.68
14 0.72
15 0.73
16 0.72
17 0.77
18 0.73
19 0.73
20 0.68
21 0.64
22 0.59
23 0.53
24 0.52
25 0.45
26 0.41
27 0.33
28 0.34
29 0.33
30 0.34
31 0.34
32 0.33
33 0.32
34 0.31
35 0.3
36 0.29
37 0.25
38 0.21
39 0.2
40 0.19
41 0.24
42 0.24
43 0.24
44 0.2
45 0.24
46 0.32
47 0.41
48 0.48
49 0.52
50 0.6
51 0.69
52 0.78
53 0.83
54 0.86
55 0.87
56 0.88
57 0.87
58 0.83
59 0.82
60 0.82
61 0.8
62 0.78
63 0.76
64 0.73
65 0.7
66 0.64
67 0.57
68 0.51
69 0.44
70 0.39