Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HCD4

Protein Details
Accession Q2HCD4   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKGKAKGQGKWKHRNKGKGGAPRADBasic
71-93EAPVLIPPKKKKKQPFRFLDLPPHydrophilic
NLS Segment(s)
PositionSequence
3-28KGKAKGQGKWKHRNKGKGGAPRADRN
79-83KKKKK
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MPKGKAKGQGKWKHRNKGKGGAPRADRNPPPTPAGPSHPTLPSPDGPSNPGDEIPKLSMNGLTLCDPDPAEAPVLIPPKKKKKQPFRFLDLPPELRIEVYTHFVTADDVVDLNTENHKYIRKKLSILKTCKLIYQEASHVFYGKNTFRIFPTQGGRYFKTKKPLLARLKSHQRRMLTSLELRLGPGWTNPPRGWVVNPALGLHDCVNVQKNTVPDLRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.84
4 0.84
5 0.83
6 0.83
7 0.81
8 0.78
9 0.76
10 0.75
11 0.73
12 0.71
13 0.67
14 0.63
15 0.61
16 0.56
17 0.55
18 0.48
19 0.48
20 0.44
21 0.46
22 0.43
23 0.39
24 0.4
25 0.36
26 0.34
27 0.33
28 0.33
29 0.29
30 0.32
31 0.32
32 0.3
33 0.3
34 0.3
35 0.29
36 0.26
37 0.24
38 0.2
39 0.17
40 0.19
41 0.19
42 0.19
43 0.17
44 0.16
45 0.15
46 0.14
47 0.14
48 0.13
49 0.11
50 0.11
51 0.12
52 0.12
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.09
59 0.08
60 0.11
61 0.16
62 0.18
63 0.22
64 0.3
65 0.4
66 0.47
67 0.55
68 0.62
69 0.68
70 0.77
71 0.83
72 0.83
73 0.8
74 0.81
75 0.75
76 0.73
77 0.66
78 0.57
79 0.47
80 0.4
81 0.32
82 0.24
83 0.22
84 0.15
85 0.11
86 0.12
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.09
93 0.08
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.05
100 0.06
101 0.06
102 0.07
103 0.08
104 0.14
105 0.16
106 0.23
107 0.3
108 0.31
109 0.35
110 0.43
111 0.52
112 0.55
113 0.59
114 0.55
115 0.53
116 0.51
117 0.49
118 0.43
119 0.35
120 0.28
121 0.24
122 0.26
123 0.23
124 0.25
125 0.23
126 0.22
127 0.2
128 0.19
129 0.21
130 0.18
131 0.2
132 0.18
133 0.19
134 0.2
135 0.25
136 0.26
137 0.26
138 0.3
139 0.29
140 0.34
141 0.38
142 0.39
143 0.42
144 0.46
145 0.45
146 0.49
147 0.48
148 0.5
149 0.53
150 0.61
151 0.63
152 0.66
153 0.69
154 0.69
155 0.77
156 0.78
157 0.78
158 0.74
159 0.68
160 0.63
161 0.61
162 0.56
163 0.5
164 0.46
165 0.41
166 0.38
167 0.34
168 0.31
169 0.27
170 0.24
171 0.18
172 0.16
173 0.21
174 0.22
175 0.28
176 0.27
177 0.31
178 0.33
179 0.34
180 0.34
181 0.34
182 0.34
183 0.33
184 0.33
185 0.3
186 0.29
187 0.27
188 0.27
189 0.21
190 0.18
191 0.14
192 0.17
193 0.23
194 0.2
195 0.22
196 0.22
197 0.23
198 0.27
199 0.32