Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RS49

Protein Details
Accession G0RS49   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28PVSHHHTSSRNRRTPRQNVSQPQRQFRGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027915  DUF4452  
KEGG tre:TRIREDRAFT_33312  -  
Pfam View protein in Pfam  
PF14618  DUF4452  
Amino Acid Sequences PVSHHHTSSRNRRTPRQNVSQPQRQFRGVRSMRELTDTAALSAFRTRFEAGRSFDLEDDLEFCPGLLTESDLVSISASERSSLASNSPEASPTQQPQTVAPAFSLNSSSPPFIPPPAVQPLNVAFRLAQPTATRGRNAIPIVNPATGASMPSPPPSMSPGRLQQQPIRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.84
4 0.83
5 0.85
6 0.87
7 0.87
8 0.84
9 0.82
10 0.77
11 0.72
12 0.65
13 0.58
14 0.6
15 0.55
16 0.53
17 0.51
18 0.5
19 0.45
20 0.46
21 0.43
22 0.33
23 0.33
24 0.27
25 0.21
26 0.17
27 0.17
28 0.13
29 0.17
30 0.15
31 0.12
32 0.14
33 0.14
34 0.15
35 0.18
36 0.23
37 0.22
38 0.25
39 0.27
40 0.26
41 0.25
42 0.24
43 0.21
44 0.16
45 0.15
46 0.11
47 0.09
48 0.08
49 0.08
50 0.07
51 0.06
52 0.07
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.11
78 0.13
79 0.13
80 0.16
81 0.16
82 0.16
83 0.16
84 0.21
85 0.19
86 0.17
87 0.16
88 0.14
89 0.13
90 0.13
91 0.14
92 0.09
93 0.11
94 0.12
95 0.12
96 0.11
97 0.13
98 0.14
99 0.13
100 0.16
101 0.14
102 0.17
103 0.23
104 0.23
105 0.22
106 0.23
107 0.25
108 0.27
109 0.26
110 0.22
111 0.15
112 0.17
113 0.21
114 0.19
115 0.18
116 0.14
117 0.18
118 0.24
119 0.26
120 0.25
121 0.22
122 0.24
123 0.28
124 0.29
125 0.29
126 0.24
127 0.27
128 0.29
129 0.28
130 0.26
131 0.2
132 0.21
133 0.17
134 0.17
135 0.13
136 0.13
137 0.14
138 0.16
139 0.19
140 0.17
141 0.18
142 0.22
143 0.26
144 0.26
145 0.31
146 0.37
147 0.41
148 0.46
149 0.5
150 0.53