Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RJ41

Protein Details
Accession G0RJ41    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSSRSSSKKFNNQRKAASIHydrophilic
57-103DVDSKKPTRPQITKKRIEKKRKKSSITFPKYSDRLAARKKKNAPKKAHydrophilic
NLS Segment(s)
PositionSequence
61-103KKPTRPQITKKRIEKKRKKSSITFPKYSDRLAARKKKNAPKKA
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG tre:TRIREDRAFT_107577  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSSKKFNNQRKAASIFGPAETARQERLSAKLLELAKQAKPEPAEMKIDAMDVDSKKPTRPQITKKRIEKKRKKSSITFPKYSDRLAARKKKNAPKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.8
4 0.74
5 0.65
6 0.56
7 0.51
8 0.42
9 0.34
10 0.3
11 0.23
12 0.2
13 0.2
14 0.19
15 0.15
16 0.15
17 0.16
18 0.15
19 0.19
20 0.21
21 0.19
22 0.18
23 0.22
24 0.22
25 0.22
26 0.23
27 0.23
28 0.2
29 0.22
30 0.22
31 0.19
32 0.19
33 0.21
34 0.2
35 0.19
36 0.21
37 0.18
38 0.18
39 0.16
40 0.15
41 0.12
42 0.1
43 0.11
44 0.09
45 0.1
46 0.13
47 0.13
48 0.15
49 0.19
50 0.25
51 0.31
52 0.39
53 0.49
54 0.57
55 0.67
56 0.75
57 0.81
58 0.85
59 0.86
60 0.89
61 0.9
62 0.9
63 0.91
64 0.91
65 0.89
66 0.87
67 0.88
68 0.88
69 0.86
70 0.8
71 0.73
72 0.72
73 0.67
74 0.59
75 0.55
76 0.49
77 0.5
78 0.54
79 0.6
80 0.61
81 0.68
82 0.77
83 0.81