FuNGI

G0RFU9

Protein Details

Accession

G0RFU9

Localization Confidence

Medium

Confidence Score

10.9

NoLS Segment(s)

Position	Sequence	Protein Nature
60-87	RTRDGCLTCRARRKRCDAAKPNGRTCIR	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, cyto 6, extr 2, mito 1, plas 1, pero 1

Family & Domain DBs

InterPro	View protein in InterPro IPR006913 CENP-V/GFA IPR021858 Fun_TF IPR011057 Mss4-like_sf IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0016846 F:carbon-sulfur lyase activity GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding
KEGG	tre:TRIREDRAFT_105784 -
Pfam	View protein in Pfam PF11951 Fungal_trans_2 PF04828 GFA PF00172 Zn_clus
PROSITE	View protein in PROSITE PS51891 CENP_V_GFA PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4

Amino Acid Sequences

MDIADIYIRVGIEASPTESASFDEPFGLGTDEADAWTSTLTPPAAATQGSNPRRKHYAPRTRDGCLTCRARRKRCDAAKPNGRTCIRINAACQWPQKLHLSHYNRQLESAGGERIAVVRSSTNASPDTRSNDTDFGGSTNRAYETKTGTAPITCVPKSPAPEHRYGPELDPSQAALERHPLSYYISVIIPQMTIVSSTGNFFTSLYIPMAFQHTAVFDLTIACSAAYLSKSASNPASQLRHVAAQRQMLAHKSIQTPLYNRDSAELSSSLLEIITLFSIGLGEKGADKSLRWMQRVNCVRELLKQHETSVAAAWTTWETVCIRGHFRYYDWMCLVMEDALDRTTRGDLSEDLFGGTTRLRDLPAARGHVWEQEFLHLQQKGFRPQRMDDAVHFMLPQSLNGKYSVTPWSGSTYPGSSLSIISCRDCWVQPCCKGHLREKPPFTGGCFCRRVRYSYDAEPVLKAICHCGGSTYSPSFIVPNSDFVITAGNPKVFSKTADSRVSIDNYLCRTCGTTLWRDSDNYKDLTTVKAGTLDEAHGVISAKIPAAETPGSLSVRLPLRSCGSSQATTWGDSVASLASLNPPKRWQTVHVKWCLHP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.13
3	0.13
4	0.14
5	0.14
6	0.15
7	0.15
8	0.15
9	0.13
10	0.13
11	0.12
12	0.12
13	0.13
14	0.13
15	0.1
16	0.09
17	0.11
18	0.1
19	0.11
20	0.11
21	0.1
22	0.08
23	0.09
24	0.09
25	0.08
26	0.11
27	0.11
28	0.1
29	0.1
30	0.12
31	0.14
32	0.13
33	0.14
34	0.19
35	0.29
36	0.37
37	0.44
38	0.45
39	0.49
40	0.56
41	0.59
42	0.62
43	0.63
44	0.67
45	0.67
46	0.76
47	0.75
48	0.71
49	0.74
50	0.67
51	0.6
52	0.58
53	0.58
54	0.56
55	0.62
56	0.68
57	0.71
58	0.76
59	0.8
60	0.81
61	0.83
62	0.86
63	0.85
64	0.86
65	0.87
66	0.87
67	0.84
68	0.82
69	0.73
70	0.66
71	0.59
72	0.58
73	0.53
74	0.47
75	0.44
76	0.43
77	0.48
78	0.5
79	0.5
80	0.45
81	0.41
82	0.42
83	0.46
84	0.4
85	0.4
86	0.44
87	0.49
88	0.51
89	0.6
90	0.64
91	0.57
92	0.55
93	0.5
94	0.41
95	0.35
96	0.31
97	0.22
98	0.14
99	0.14
100	0.12
101	0.13
102	0.13
103	0.11
104	0.09
105	0.08
106	0.1
107	0.14
108	0.14
109	0.16
110	0.17
111	0.19
112	0.21
113	0.25
114	0.29
115	0.29
116	0.31
117	0.31
118	0.3
119	0.29
120	0.27
121	0.23
122	0.19
123	0.18
124	0.16
125	0.13
126	0.13
127	0.14
128	0.14
129	0.15
130	0.16
131	0.19
132	0.21
133	0.22
134	0.22
135	0.21
136	0.21
137	0.21
138	0.22
139	0.23
140	0.2
141	0.21
142	0.23
143	0.25
144	0.29
145	0.33
146	0.39
147	0.38
148	0.43
149	0.44
150	0.43
151	0.42
152	0.39
153	0.36
154	0.33
155	0.3
156	0.26
157	0.23
158	0.22
159	0.2
160	0.21
161	0.19
162	0.13
163	0.17
164	0.18
165	0.18
166	0.18
167	0.17
168	0.17
169	0.18
170	0.18
171	0.13
172	0.12
173	0.12
174	0.12
175	0.11
176	0.09
177	0.07
178	0.07
179	0.05
180	0.06
181	0.05
182	0.06
183	0.06
184	0.07
185	0.07
186	0.08
187	0.08
188	0.08
189	0.09
190	0.09
191	0.1
192	0.1
193	0.1
194	0.09
195	0.1
196	0.13
197	0.12
198	0.11
199	0.1
200	0.09
201	0.1
202	0.1
203	0.09
204	0.06
205	0.06
206	0.06
207	0.06
208	0.06
209	0.04
210	0.04
211	0.04
212	0.06
213	0.06
214	0.06
215	0.07
216	0.1
217	0.1
218	0.13
219	0.14
220	0.13
221	0.14
222	0.19
223	0.21
224	0.17
225	0.19
226	0.18
227	0.22
228	0.22
229	0.25
230	0.24
231	0.23
232	0.24
233	0.24
234	0.24
235	0.21
236	0.23
237	0.19
238	0.19
239	0.18
240	0.19
241	0.2
242	0.21
243	0.22
244	0.24
245	0.28
246	0.25
247	0.24
248	0.23
249	0.22
250	0.2
251	0.2
252	0.15
253	0.11
254	0.1
255	0.1
256	0.08
257	0.07
258	0.06
259	0.04
260	0.04
261	0.03
262	0.03
263	0.03
264	0.03
265	0.03
266	0.03
267	0.03
268	0.03
269	0.03
270	0.04
271	0.04
272	0.06
273	0.06
274	0.06
275	0.1
276	0.17
277	0.21
278	0.22
279	0.26
280	0.26
281	0.36
282	0.43
283	0.43
284	0.39
285	0.37
286	0.36
287	0.37
288	0.39
289	0.35
290	0.33
291	0.29
292	0.27
293	0.28
294	0.28
295	0.23
296	0.2
297	0.14
298	0.09
299	0.08
300	0.08
301	0.06
302	0.06
303	0.05
304	0.06
305	0.06
306	0.08
307	0.1
308	0.11
309	0.14
310	0.14
311	0.16
312	0.16
313	0.16
314	0.23
315	0.23
316	0.24
317	0.22
318	0.22
319	0.2
320	0.19
321	0.19
322	0.1
323	0.09
324	0.06
325	0.06
326	0.05
327	0.05
328	0.05
329	0.06
330	0.06
331	0.06
332	0.07
333	0.08
334	0.08
335	0.09
336	0.1
337	0.1
338	0.09
339	0.09
340	0.08
341	0.08
342	0.08
343	0.06
344	0.06
345	0.07
346	0.07
347	0.09
348	0.1
349	0.16
350	0.19
351	0.23
352	0.23
353	0.24
354	0.24
355	0.27
356	0.27
357	0.22
358	0.18
359	0.17
360	0.18
361	0.17
362	0.22
363	0.19
364	0.18
365	0.22
366	0.26
367	0.33
368	0.37
369	0.39
370	0.38
371	0.37
372	0.45
373	0.44
374	0.42
375	0.34
376	0.36
377	0.34
378	0.3
379	0.28
380	0.21
381	0.19
382	0.17
383	0.16
384	0.11
385	0.11
386	0.12
387	0.13
388	0.14
389	0.11
390	0.13
391	0.16
392	0.15
393	0.15
394	0.15
395	0.19
396	0.18
397	0.19
398	0.18
399	0.16
400	0.16
401	0.16
402	0.16
403	0.12
404	0.13
405	0.12
406	0.14
407	0.14
408	0.14
409	0.13
410	0.15
411	0.17
412	0.17
413	0.2
414	0.24
415	0.3
416	0.36
417	0.39
418	0.42
419	0.47
420	0.51
421	0.56
422	0.6
423	0.61
424	0.63
425	0.64
426	0.63
427	0.6
428	0.56
429	0.5
430	0.49
431	0.43
432	0.43
433	0.44
434	0.41
435	0.45
436	0.46
437	0.46
438	0.43
439	0.46
440	0.43
441	0.44
442	0.49
443	0.45
444	0.43
445	0.4
446	0.35
447	0.29
448	0.24
449	0.18
450	0.15
451	0.13
452	0.13
453	0.13
454	0.14
455	0.15
456	0.17
457	0.22
458	0.2
459	0.19
460	0.19
461	0.19
462	0.18
463	0.17
464	0.2
465	0.16
466	0.17
467	0.18
468	0.18
469	0.18
470	0.17
471	0.2
472	0.14
473	0.18
474	0.18
475	0.17
476	0.18
477	0.18
478	0.22
479	0.2
480	0.22
481	0.24
482	0.29
483	0.36
484	0.4
485	0.41
486	0.4
487	0.44
488	0.45
489	0.39
490	0.33
491	0.3
492	0.3
493	0.29
494	0.26
495	0.23
496	0.22
497	0.21
498	0.24
499	0.25
500	0.28
501	0.32
502	0.36
503	0.38
504	0.37
505	0.39
506	0.41
507	0.4
508	0.35
509	0.3
510	0.29
511	0.28
512	0.28
513	0.28
514	0.23
515	0.19
516	0.2
517	0.2
518	0.19
519	0.19
520	0.17
521	0.16
522	0.14
523	0.13
524	0.11
525	0.12
526	0.1
527	0.1
528	0.1
529	0.1
530	0.1
531	0.1
532	0.1
533	0.13
534	0.14
535	0.12
536	0.15
537	0.19
538	0.19
539	0.19
540	0.19
541	0.21
542	0.25
543	0.28
544	0.26
545	0.26
546	0.31
547	0.32
548	0.33
549	0.35
550	0.35
551	0.34
552	0.33
553	0.37
554	0.33
555	0.33
556	0.32
557	0.25
558	0.19
559	0.17
560	0.18
561	0.1
562	0.08
563	0.07
564	0.07
565	0.14
566	0.22
567	0.24
568	0.27
569	0.33
570	0.38
571	0.42
572	0.46
573	0.47
574	0.5
575	0.58
576	0.65
577	0.69

G0RFU9

3D AlphaFold-predicted Structure Viewer