Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RS17

Protein Details
Accession G0RS17    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
324-345ITSYSSKMLKHKRMKANGAGVMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000620  EamA_dom  
Gene Ontology GO:0030659  C:cytoplasmic vesicle membrane  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0000139  C:Golgi membrane  
GO:0008643  P:carbohydrate transport  
KEGG tre:TRIREDRAFT_67030  -  
Pfam View protein in Pfam  
PF00892  EamA  
Amino Acid Sequences MHDPEKNAGKEATRDASPGLLASSDGAAEPKPASHPLQVISWMVVNTLATVFTNKAIFSEPMWKQSQLTFASIHFLTTWFILFLLSRSPVGVFVPRRAPTLHLIPLATAMCFNVILPNLSLAYSTVTFYQIARIMLTPTVAIMNLVLYDQGLPRGAVLALIPTCLGVGMVTYYDSIPVGDDATKTTSLLGIIFAFTGVFASSLYTVGIAGYHRKLNMNSMQLLFLQAPMACFLLLFFIPFIDKLPTLGHVPIRLNKGILIIMSTLFASLVNISQFYIVAQTGPVSSTVVGHIKTCIIVGLGWAISGRPIGDKSALGVVIAVAGITSYSSKMLKHKRMKANGAGVMAAGKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.24
5 0.2
6 0.15
7 0.1
8 0.09
9 0.09
10 0.09
11 0.07
12 0.07
13 0.08
14 0.08
15 0.09
16 0.09
17 0.1
18 0.12
19 0.16
20 0.19
21 0.22
22 0.24
23 0.24
24 0.26
25 0.27
26 0.25
27 0.22
28 0.21
29 0.17
30 0.15
31 0.13
32 0.11
33 0.09
34 0.09
35 0.08
36 0.07
37 0.08
38 0.09
39 0.11
40 0.12
41 0.11
42 0.11
43 0.14
44 0.15
45 0.15
46 0.24
47 0.23
48 0.29
49 0.32
50 0.32
51 0.3
52 0.31
53 0.36
54 0.28
55 0.29
56 0.24
57 0.21
58 0.25
59 0.23
60 0.21
61 0.15
62 0.14
63 0.12
64 0.11
65 0.11
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.09
73 0.09
74 0.09
75 0.1
76 0.1
77 0.11
78 0.17
79 0.16
80 0.19
81 0.26
82 0.27
83 0.29
84 0.29
85 0.3
86 0.28
87 0.31
88 0.31
89 0.26
90 0.25
91 0.23
92 0.24
93 0.22
94 0.18
95 0.12
96 0.08
97 0.07
98 0.07
99 0.07
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.08
108 0.06
109 0.08
110 0.07
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.11
117 0.12
118 0.12
119 0.12
120 0.12
121 0.12
122 0.11
123 0.11
124 0.09
125 0.06
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.02
154 0.02
155 0.02
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.05
168 0.06
169 0.08
170 0.08
171 0.08
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.03
183 0.04
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.07
197 0.09
198 0.1
199 0.11
200 0.13
201 0.14
202 0.18
203 0.23
204 0.23
205 0.24
206 0.23
207 0.23
208 0.21
209 0.22
210 0.17
211 0.12
212 0.1
213 0.08
214 0.08
215 0.07
216 0.08
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.05
224 0.05
225 0.06
226 0.06
227 0.08
228 0.08
229 0.08
230 0.09
231 0.1
232 0.11
233 0.13
234 0.15
235 0.15
236 0.17
237 0.2
238 0.24
239 0.27
240 0.26
241 0.25
242 0.23
243 0.23
244 0.2
245 0.17
246 0.13
247 0.09
248 0.08
249 0.08
250 0.08
251 0.06
252 0.06
253 0.06
254 0.05
255 0.05
256 0.06
257 0.06
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.08
264 0.07
265 0.06
266 0.06
267 0.07
268 0.07
269 0.07
270 0.08
271 0.07
272 0.07
273 0.07
274 0.1
275 0.13
276 0.13
277 0.13
278 0.14
279 0.13
280 0.13
281 0.13
282 0.1
283 0.08
284 0.07
285 0.07
286 0.08
287 0.08
288 0.07
289 0.07
290 0.07
291 0.07
292 0.08
293 0.08
294 0.08
295 0.09
296 0.11
297 0.13
298 0.13
299 0.15
300 0.18
301 0.17
302 0.15
303 0.14
304 0.11
305 0.1
306 0.09
307 0.07
308 0.03
309 0.03
310 0.03
311 0.04
312 0.05
313 0.05
314 0.08
315 0.09
316 0.12
317 0.22
318 0.33
319 0.43
320 0.53
321 0.62
322 0.71
323 0.79
324 0.85
325 0.84
326 0.82
327 0.77
328 0.68
329 0.57
330 0.47