Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RCU5

Protein Details
Accession G0RCU5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-117HLPGLKPKPKPKPLPQPQPQPGPPHydrophilic
NLS Segment(s)
PositionSequence
98-106LKPKPKPKP
Subcellular Location(s) extr 26
Family & Domain DBs
KEGG tre:TRIREDRAFT_120697  -  
Amino Acid Sequences MKTASFALVSALLLGASALTLPPQPTPSSGCCCCDISKGRIDCDRSIPASECFCAQVICPANAPTVWHGTPPPTSPPTSPPTSGPTLAAAPPPHLPGLKPKPKPKPLPQPQPQPGPPKQCCCCDPSVMKIRCEIKPAIDCICLAVMCPSGAETIFVKPSPTSKPTAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.03
4 0.03
5 0.03
6 0.04
7 0.06
8 0.07
9 0.09
10 0.11
11 0.12
12 0.14
13 0.19
14 0.23
15 0.28
16 0.3
17 0.31
18 0.31
19 0.33
20 0.32
21 0.34
22 0.35
23 0.32
24 0.38
25 0.38
26 0.39
27 0.42
28 0.45
29 0.41
30 0.4
31 0.4
32 0.34
33 0.34
34 0.32
35 0.29
36 0.27
37 0.25
38 0.2
39 0.17
40 0.16
41 0.13
42 0.11
43 0.15
44 0.15
45 0.16
46 0.16
47 0.16
48 0.16
49 0.16
50 0.17
51 0.12
52 0.14
53 0.13
54 0.13
55 0.13
56 0.14
57 0.16
58 0.16
59 0.19
60 0.17
61 0.18
62 0.19
63 0.23
64 0.25
65 0.27
66 0.26
67 0.23
68 0.25
69 0.26
70 0.25
71 0.21
72 0.17
73 0.16
74 0.15
75 0.16
76 0.12
77 0.11
78 0.12
79 0.12
80 0.12
81 0.11
82 0.11
83 0.18
84 0.28
85 0.36
86 0.42
87 0.49
88 0.59
89 0.68
90 0.76
91 0.76
92 0.78
93 0.79
94 0.83
95 0.84
96 0.84
97 0.81
98 0.81
99 0.77
100 0.74
101 0.7
102 0.69
103 0.65
104 0.63
105 0.61
106 0.58
107 0.54
108 0.5
109 0.46
110 0.43
111 0.41
112 0.4
113 0.47
114 0.46
115 0.45
116 0.47
117 0.49
118 0.44
119 0.46
120 0.39
121 0.35
122 0.35
123 0.37
124 0.33
125 0.29
126 0.27
127 0.24
128 0.24
129 0.18
130 0.14
131 0.13
132 0.11
133 0.1
134 0.1
135 0.09
136 0.09
137 0.09
138 0.1
139 0.1
140 0.12
141 0.15
142 0.15
143 0.17
144 0.17
145 0.21
146 0.26
147 0.28
148 0.31