Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0R881

Protein Details
Accession G0R881    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SEEFQKLKRSNDKNRLLRYIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 11.5, cyto 10.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002108  ADF-H  
IPR029006  ADF-H/Gelsolin-like_dom_sf  
IPR017904  ADF/Cofilin  
Gene Ontology GO:0015629  C:actin cytoskeleton  
GO:0016363  C:nuclear matrix  
GO:0003779  F:actin binding  
GO:0030042  P:actin filament depolymerization  
KEGG tre:TRIREDRAFT_73967  -  
Pfam View protein in Pfam  
PF00241  Cofilin_ADF  
PROSITE View protein in PROSITE  
PS51263  ADF_H  
CDD cd11286  ADF_cofilin_like  
Amino Acid Sequences MSQSGAKVSPQVSEEFQKLKRSNDKNRLLRYIIFKLSDDYSEIEVEHAEPDSDWENFREKLLSATSKSKTGAVGKGPRYAVYDFGFKFDGRDINKIILIAWSPDDAGVHPKMIYAASKEALKRSLEGFAYEIQANDSDDLEHSSILSAVLAKMNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.4
5 0.41
6 0.47
7 0.53
8 0.59
9 0.66
10 0.71
11 0.78
12 0.77
13 0.81
14 0.79
15 0.72
16 0.67
17 0.63
18 0.58
19 0.51
20 0.44
21 0.37
22 0.34
23 0.32
24 0.28
25 0.22
26 0.18
27 0.16
28 0.15
29 0.14
30 0.12
31 0.11
32 0.1
33 0.09
34 0.07
35 0.06
36 0.05
37 0.07
38 0.09
39 0.09
40 0.09
41 0.1
42 0.14
43 0.14
44 0.15
45 0.14
46 0.12
47 0.13
48 0.16
49 0.17
50 0.16
51 0.22
52 0.23
53 0.24
54 0.24
55 0.23
56 0.22
57 0.22
58 0.22
59 0.22
60 0.28
61 0.28
62 0.31
63 0.3
64 0.29
65 0.29
66 0.26
67 0.23
68 0.18
69 0.2
70 0.16
71 0.18
72 0.18
73 0.15
74 0.16
75 0.14
76 0.18
77 0.16
78 0.18
79 0.18
80 0.18
81 0.18
82 0.18
83 0.16
84 0.12
85 0.11
86 0.09
87 0.08
88 0.07
89 0.07
90 0.07
91 0.07
92 0.06
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.1
99 0.11
100 0.12
101 0.1
102 0.12
103 0.14
104 0.17
105 0.18
106 0.2
107 0.23
108 0.23
109 0.22
110 0.2
111 0.23
112 0.21
113 0.21
114 0.2
115 0.18
116 0.2
117 0.19
118 0.18
119 0.14
120 0.15
121 0.14
122 0.13
123 0.12
124 0.1
125 0.1
126 0.13
127 0.13
128 0.11
129 0.1
130 0.1
131 0.1
132 0.09
133 0.09
134 0.07
135 0.07