Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0R8U6

Protein Details
Accession G0R8U6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
198-222ATNGGSRKPGRPKKDKKAAPVVGKTHydrophilic
NLS Segment(s)
PositionSequence
196-225KAATNGGSRKPGRPKKDKKAAPVVGKTLRK
Subcellular Location(s) cyto 14.5, cyto_nucl 13.333, nucl 11, mito_nucl 6.333
Family & Domain DBs
KEGG tre:TRIREDRAFT_102985  -  
Amino Acid Sequences MSDGIAPAVDKVELPIIGDTKAPEDAKPAQEPPSAADAPKESHKPPHAVEVQSVPETPVNASTPANGSPRPELPISAEPEESEKPKEDPVPITEVQEPLPTPSASAPGSDVGPDSIVDKPVTPNGESKPAELMAGALQTGNAEDKSETSSTAAGEKRKQPDTAEAVTAADEAAAEKEDSEESERADKKVKIDENGKAATNGGSRKPGRPKKDKKAAPVVGKTLRKTRSQGPVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.14
5 0.15
6 0.14
7 0.14
8 0.19
9 0.18
10 0.16
11 0.2
12 0.25
13 0.29
14 0.33
15 0.33
16 0.32
17 0.34
18 0.34
19 0.32
20 0.33
21 0.29
22 0.25
23 0.26
24 0.23
25 0.24
26 0.29
27 0.31
28 0.26
29 0.33
30 0.38
31 0.4
32 0.39
33 0.45
34 0.45
35 0.42
36 0.42
37 0.38
38 0.36
39 0.33
40 0.31
41 0.24
42 0.19
43 0.18
44 0.16
45 0.14
46 0.13
47 0.13
48 0.13
49 0.13
50 0.14
51 0.16
52 0.19
53 0.17
54 0.18
55 0.19
56 0.21
57 0.23
58 0.21
59 0.19
60 0.21
61 0.25
62 0.28
63 0.26
64 0.25
65 0.22
66 0.25
67 0.26
68 0.23
69 0.2
70 0.17
71 0.16
72 0.19
73 0.21
74 0.2
75 0.2
76 0.21
77 0.25
78 0.23
79 0.25
80 0.24
81 0.22
82 0.2
83 0.19
84 0.17
85 0.13
86 0.14
87 0.11
88 0.11
89 0.1
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.09
96 0.08
97 0.08
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.07
106 0.08
107 0.1
108 0.12
109 0.11
110 0.14
111 0.14
112 0.22
113 0.22
114 0.22
115 0.21
116 0.2
117 0.19
118 0.16
119 0.15
120 0.07
121 0.07
122 0.06
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.04
129 0.05
130 0.05
131 0.06
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.1
138 0.14
139 0.17
140 0.17
141 0.22
142 0.28
143 0.33
144 0.35
145 0.36
146 0.34
147 0.38
148 0.4
149 0.37
150 0.33
151 0.27
152 0.25
153 0.23
154 0.21
155 0.14
156 0.07
157 0.05
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.08
166 0.11
167 0.12
168 0.13
169 0.21
170 0.22
171 0.23
172 0.29
173 0.3
174 0.3
175 0.38
176 0.4
177 0.39
178 0.44
179 0.47
180 0.47
181 0.48
182 0.45
183 0.37
184 0.33
185 0.29
186 0.27
187 0.26
188 0.22
189 0.28
190 0.3
191 0.38
192 0.48
193 0.55
194 0.61
195 0.69
196 0.77
197 0.79
198 0.88
199 0.87
200 0.86
201 0.87
202 0.86
203 0.84
204 0.8
205 0.77
206 0.75
207 0.74
208 0.69
209 0.67
210 0.63
211 0.59
212 0.57
213 0.58
214 0.59