Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RW80

Protein Details
Accession G0RW80   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22KKGRKLIKNKNKYLYNKKPFLLHydrophilic
NLS Segment(s)
PositionSequence
52-66KLKFKLKFKAEFKAG
93-93K
95-95K
Subcellular Location(s) mito 12.5, cyto_mito 10.666, cyto_nucl 7.833, cyto 7.5, nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG tre:TRIREDRAFT_112103  -  
Amino Acid Sequences KKGRKLIKNKNKYLYNKKPFLLFFFFKAYLSKSFLIVEFKLEFKVEFKVKFKLKFKLKFKAEFKAGKEFKLEFKNLEFKAEFKFSKEFKVKFKVKFKVGKEFKAEFKLSKEFIFSKEFKVEFKVKFKLEFKLEFKVKFKFKFKLEFKLGKEFKLEFRFSKEFKFKFKVFFINLLKGAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.83
4 0.76
5 0.72
6 0.65
7 0.61
8 0.57
9 0.48
10 0.41
11 0.41
12 0.39
13 0.34
14 0.34
15 0.3
16 0.26
17 0.28
18 0.26
19 0.2
20 0.21
21 0.22
22 0.24
23 0.21
24 0.22
25 0.18
26 0.18
27 0.18
28 0.17
29 0.16
30 0.13
31 0.19
32 0.2
33 0.23
34 0.25
35 0.32
36 0.38
37 0.46
38 0.5
39 0.53
40 0.59
41 0.64
42 0.68
43 0.71
44 0.71
45 0.72
46 0.7
47 0.69
48 0.66
49 0.62
50 0.58
51 0.58
52 0.53
53 0.45
54 0.45
55 0.38
56 0.36
57 0.36
58 0.34
59 0.24
60 0.27
61 0.33
62 0.3
63 0.32
64 0.27
65 0.22
66 0.24
67 0.28
68 0.25
69 0.2
70 0.25
71 0.21
72 0.29
73 0.35
74 0.34
75 0.34
76 0.44
77 0.48
78 0.51
79 0.59
80 0.57
81 0.58
82 0.63
83 0.61
84 0.63
85 0.61
86 0.58
87 0.56
88 0.52
89 0.48
90 0.46
91 0.44
92 0.35
93 0.35
94 0.34
95 0.28
96 0.26
97 0.26
98 0.21
99 0.23
100 0.27
101 0.24
102 0.24
103 0.28
104 0.28
105 0.25
106 0.3
107 0.33
108 0.32
109 0.37
110 0.4
111 0.36
112 0.42
113 0.44
114 0.45
115 0.44
116 0.46
117 0.44
118 0.47
119 0.5
120 0.47
121 0.48
122 0.5
123 0.52
124 0.52
125 0.55
126 0.53
127 0.54
128 0.6
129 0.62
130 0.64
131 0.66
132 0.66
133 0.63
134 0.67
135 0.64
136 0.55
137 0.54
138 0.47
139 0.46
140 0.46
141 0.45
142 0.37
143 0.44
144 0.49
145 0.46
146 0.53
147 0.55
148 0.52
149 0.56
150 0.62
151 0.57
152 0.57
153 0.6
154 0.59
155 0.53
156 0.59
157 0.56
158 0.55