Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RF30

Protein Details
Accession G0RF30    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-32MPTSADPRSKRPTKKRALTPTSAQHydrophilic
118-151RAEKLRRDEEKTRKNREKREKAKARKMNKGKGGDBasic
NLS Segment(s)
PositionSequence
116-149KSRAEKLRRDEEKTRKNREKREKAKARKMNKGKG
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
KEGG tre:TRIREDRAFT_105535  -  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSAEGPESMPTSADPRSKRPTKKRALTPTSAQAASLDALFAKPDQEIRIPPPPSALAPGSKRPPPPEIVTNVQGSSAGAGSGEFHVYKAARRREYERLREMDEEVKREREQAEFEKSRAEKLRRDEEKTRKNREKREKAKARKMNKGKGGDDANGNGTTASAASGADDSSREKGKPDTEDNGRNGSANATAASAEPAVGLVIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.43
4 0.52
5 0.62
6 0.7
7 0.75
8 0.79
9 0.86
10 0.89
11 0.89
12 0.88
13 0.84
14 0.79
15 0.77
16 0.71
17 0.61
18 0.5
19 0.39
20 0.32
21 0.26
22 0.2
23 0.12
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.08
31 0.11
32 0.13
33 0.16
34 0.21
35 0.29
36 0.3
37 0.29
38 0.3
39 0.29
40 0.27
41 0.28
42 0.24
43 0.21
44 0.24
45 0.3
46 0.32
47 0.36
48 0.38
49 0.38
50 0.4
51 0.38
52 0.39
53 0.37
54 0.38
55 0.38
56 0.38
57 0.36
58 0.32
59 0.28
60 0.23
61 0.18
62 0.13
63 0.09
64 0.05
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.05
71 0.05
72 0.07
73 0.08
74 0.11
75 0.18
76 0.25
77 0.28
78 0.31
79 0.36
80 0.45
81 0.53
82 0.57
83 0.56
84 0.52
85 0.51
86 0.49
87 0.45
88 0.42
89 0.35
90 0.31
91 0.26
92 0.26
93 0.23
94 0.24
95 0.23
96 0.17
97 0.2
98 0.2
99 0.27
100 0.26
101 0.26
102 0.31
103 0.3
104 0.33
105 0.37
106 0.36
107 0.32
108 0.37
109 0.48
110 0.47
111 0.53
112 0.58
113 0.62
114 0.69
115 0.73
116 0.77
117 0.77
118 0.8
119 0.84
120 0.86
121 0.87
122 0.86
123 0.88
124 0.88
125 0.89
126 0.91
127 0.9
128 0.87
129 0.86
130 0.86
131 0.84
132 0.81
133 0.77
134 0.68
135 0.65
136 0.6
137 0.51
138 0.44
139 0.36
140 0.31
141 0.24
142 0.23
143 0.16
144 0.13
145 0.11
146 0.08
147 0.07
148 0.04
149 0.04
150 0.05
151 0.05
152 0.05
153 0.06
154 0.07
155 0.08
156 0.12
157 0.15
158 0.15
159 0.17
160 0.21
161 0.26
162 0.32
163 0.35
164 0.4
165 0.45
166 0.52
167 0.53
168 0.53
169 0.48
170 0.42
171 0.37
172 0.3
173 0.24
174 0.17
175 0.15
176 0.1
177 0.1
178 0.1
179 0.11
180 0.1
181 0.08
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06