Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0RTJ3

Protein Details
Accession G0RTJ3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-32SAMPRHSVPTRKRPRRAFRLLSAHydrophilic
NLS Segment(s)
PositionSequence
21-24KRPR
Subcellular Location(s) mito 13.5, mito_nucl 12, nucl 9.5, cyto 4
Family & Domain DBs
KEGG tre:TRIREDRAFT_111012  -  
Amino Acid Sequences MHENQQTCLSAMPRHSVPTRKRPRRAFRLLSAVKDPTLPYFKNYTILILLAKIKANKAIYFTYFKTSFLNKDLEEISKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.37
4 0.43
5 0.5
6 0.6
7 0.65
8 0.73
9 0.79
10 0.85
11 0.86
12 0.89
13 0.84
14 0.78
15 0.79
16 0.71
17 0.64
18 0.57
19 0.47
20 0.38
21 0.32
22 0.26
23 0.19
24 0.2
25 0.17
26 0.16
27 0.19
28 0.19
29 0.21
30 0.2
31 0.18
32 0.14
33 0.15
34 0.12
35 0.1
36 0.11
37 0.1
38 0.12
39 0.12
40 0.12
41 0.16
42 0.18
43 0.18
44 0.2
45 0.21
46 0.23
47 0.27
48 0.28
49 0.31
50 0.29
51 0.29
52 0.3
53 0.31
54 0.3
55 0.29
56 0.33
57 0.26
58 0.29
59 0.3