Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RN23

Protein Details
Accession G0RN23    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29VTTAPSAPTQRQRRPRPTRPRTDEELAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 5, nucl 4, plas 3, cyto_pero 3
Family & Domain DBs
KEGG tre:TRIREDRAFT_108667  -  
Amino Acid Sequences MGVTTAPSAPTQRQRRPRPTRPRTDEELAAREANRVRRWISRVREVRIRLTEEESRIYNGLSHHDGDGQVALVWSSGEWAVWRRGERLRALVEEELDVFAFLEVLCLMDCTIEETASNGRRRMTFQRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.77
3 0.84
4 0.89
5 0.9
6 0.91
7 0.92
8 0.91
9 0.88
10 0.84
11 0.79
12 0.74
13 0.67
14 0.6
15 0.51
16 0.44
17 0.37
18 0.33
19 0.32
20 0.32
21 0.3
22 0.29
23 0.29
24 0.33
25 0.38
26 0.43
27 0.45
28 0.49
29 0.53
30 0.54
31 0.59
32 0.56
33 0.57
34 0.53
35 0.5
36 0.42
37 0.4
38 0.38
39 0.32
40 0.32
41 0.26
42 0.23
43 0.19
44 0.18
45 0.14
46 0.12
47 0.13
48 0.13
49 0.12
50 0.11
51 0.12
52 0.12
53 0.1
54 0.1
55 0.07
56 0.05
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.06
67 0.09
68 0.12
69 0.13
70 0.16
71 0.2
72 0.24
73 0.25
74 0.28
75 0.28
76 0.27
77 0.29
78 0.26
79 0.23
80 0.2
81 0.18
82 0.14
83 0.11
84 0.1
85 0.07
86 0.06
87 0.05
88 0.04
89 0.05
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.07
98 0.08
99 0.08
100 0.08
101 0.09
102 0.17
103 0.24
104 0.28
105 0.27
106 0.3
107 0.32
108 0.38