Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0RB29

Protein Details
Accession G0RB29    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-109QDTWSEQKPQRRQDGRKRPFRADRIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
KEGG tre:TRIREDRAFT_55201  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences RKILRDTIQGITKPAIRRLARRGGVKRISATIYDEMRKVLKIFLEDVLRDACTYVEYRNAKTVTVEDVLHSLRRRGRTLYGFDQDTWSEQKPQRRQDGRKRPFRADRIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.37
4 0.43
5 0.48
6 0.55
7 0.56
8 0.61
9 0.62
10 0.63
11 0.65
12 0.62
13 0.56
14 0.49
15 0.44
16 0.36
17 0.34
18 0.29
19 0.27
20 0.25
21 0.23
22 0.22
23 0.21
24 0.21
25 0.17
26 0.14
27 0.12
28 0.12
29 0.13
30 0.14
31 0.15
32 0.14
33 0.15
34 0.14
35 0.13
36 0.12
37 0.11
38 0.08
39 0.07
40 0.07
41 0.07
42 0.13
43 0.14
44 0.15
45 0.2
46 0.21
47 0.2
48 0.2
49 0.2
50 0.16
51 0.16
52 0.15
53 0.11
54 0.12
55 0.13
56 0.16
57 0.16
58 0.17
59 0.19
60 0.23
61 0.25
62 0.26
63 0.32
64 0.34
65 0.41
66 0.44
67 0.45
68 0.43
69 0.41
70 0.41
71 0.35
72 0.32
73 0.29
74 0.24
75 0.27
76 0.3
77 0.39
78 0.45
79 0.53
80 0.61
81 0.67
82 0.75
83 0.79
84 0.86
85 0.87
86 0.89
87 0.87
88 0.86
89 0.87