Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0R706

Protein Details
Accession G0R706    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
297-316ARKRGAPGAARPKRRRPEYDBasic
361-382DEDDAPRPKRQRTKEPEDDEDAAcidic
NLS Segment(s)
PositionSequence
261-268MKAQRKRD
292-312EGPRSARKRGAPGAARPKRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG tre:TRIREDRAFT_21152  -  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MSDSEDPLDAIDEGGDDLFGDEGDEGDASPQARILDDDDLASDPEAYGEAEQREYDGSQARHETKDRVVMAVQAYRHRIPKPTDDALRVMRVPKFVKFLPEPYDPDTWQPSQFDLENARAEHPKHVVRVRRDPSTNELKSNTNIYRWSDGSVTIAVGGEHYEIQKKALAPAQGQPYDELKDGHYYAAAAELSSNLLMTVGHLTEQYTIRPNKAVGDDALSILAERMAMASKSSTGGDMIIKTVIDPELQKKQAELAEKERMKAQRKRDSAAAKMDGGVGRTGRTGLSIGGLEGPRSARKRGAPGAARPKRRRPEYDSDDDLPQGVARHEEYDLDDGFLVGSDEEEMESDAEEEEEEDILDDEDDAPRPKRQRTKEPEDDEDAEGDEVEPETHGRSGRRRNVIDDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.05
13 0.06
14 0.08
15 0.08
16 0.08
17 0.1
18 0.1
19 0.1
20 0.11
21 0.13
22 0.14
23 0.14
24 0.14
25 0.14
26 0.15
27 0.15
28 0.14
29 0.11
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.11
36 0.12
37 0.13
38 0.13
39 0.14
40 0.15
41 0.14
42 0.16
43 0.19
44 0.19
45 0.22
46 0.29
47 0.32
48 0.35
49 0.38
50 0.39
51 0.36
52 0.43
53 0.39
54 0.34
55 0.31
56 0.3
57 0.3
58 0.3
59 0.29
60 0.26
61 0.3
62 0.31
63 0.36
64 0.35
65 0.38
66 0.39
67 0.46
68 0.49
69 0.51
70 0.53
71 0.51
72 0.53
73 0.5
74 0.49
75 0.42
76 0.38
77 0.33
78 0.34
79 0.33
80 0.31
81 0.32
82 0.3
83 0.35
84 0.34
85 0.36
86 0.37
87 0.39
88 0.4
89 0.39
90 0.42
91 0.36
92 0.36
93 0.36
94 0.32
95 0.3
96 0.27
97 0.24
98 0.23
99 0.23
100 0.22
101 0.2
102 0.21
103 0.22
104 0.22
105 0.23
106 0.24
107 0.24
108 0.25
109 0.27
110 0.27
111 0.3
112 0.35
113 0.4
114 0.44
115 0.53
116 0.54
117 0.56
118 0.56
119 0.54
120 0.54
121 0.57
122 0.52
123 0.45
124 0.43
125 0.38
126 0.37
127 0.4
128 0.35
129 0.27
130 0.27
131 0.27
132 0.28
133 0.26
134 0.26
135 0.2
136 0.19
137 0.18
138 0.16
139 0.13
140 0.09
141 0.09
142 0.07
143 0.06
144 0.06
145 0.05
146 0.05
147 0.06
148 0.08
149 0.08
150 0.09
151 0.12
152 0.12
153 0.14
154 0.16
155 0.18
156 0.16
157 0.21
158 0.27
159 0.26
160 0.26
161 0.25
162 0.23
163 0.23
164 0.23
165 0.18
166 0.13
167 0.14
168 0.14
169 0.12
170 0.11
171 0.09
172 0.08
173 0.09
174 0.08
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.07
191 0.08
192 0.09
193 0.14
194 0.15
195 0.15
196 0.16
197 0.16
198 0.17
199 0.17
200 0.17
201 0.12
202 0.14
203 0.13
204 0.12
205 0.12
206 0.09
207 0.08
208 0.07
209 0.07
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.04
216 0.04
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.07
223 0.07
224 0.07
225 0.08
226 0.07
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.08
233 0.11
234 0.18
235 0.2
236 0.2
237 0.2
238 0.22
239 0.25
240 0.29
241 0.28
242 0.27
243 0.35
244 0.36
245 0.36
246 0.39
247 0.42
248 0.46
249 0.49
250 0.53
251 0.53
252 0.56
253 0.58
254 0.6
255 0.59
256 0.55
257 0.56
258 0.48
259 0.38
260 0.35
261 0.34
262 0.28
263 0.23
264 0.19
265 0.13
266 0.11
267 0.1
268 0.1
269 0.08
270 0.08
271 0.08
272 0.07
273 0.08
274 0.07
275 0.07
276 0.11
277 0.11
278 0.1
279 0.11
280 0.12
281 0.17
282 0.19
283 0.21
284 0.23
285 0.26
286 0.34
287 0.38
288 0.45
289 0.45
290 0.52
291 0.61
292 0.65
293 0.72
294 0.72
295 0.77
296 0.78
297 0.8
298 0.79
299 0.76
300 0.79
301 0.77
302 0.78
303 0.74
304 0.67
305 0.6
306 0.53
307 0.44
308 0.33
309 0.25
310 0.18
311 0.12
312 0.11
313 0.11
314 0.12
315 0.12
316 0.13
317 0.14
318 0.16
319 0.16
320 0.15
321 0.14
322 0.12
323 0.12
324 0.1
325 0.09
326 0.05
327 0.05
328 0.04
329 0.05
330 0.05
331 0.05
332 0.06
333 0.06
334 0.06
335 0.06
336 0.06
337 0.06
338 0.06
339 0.06
340 0.06
341 0.06
342 0.06
343 0.06
344 0.06
345 0.06
346 0.06
347 0.06
348 0.06
349 0.08
350 0.11
351 0.14
352 0.16
353 0.23
354 0.29
355 0.38
356 0.47
357 0.55
358 0.64
359 0.7
360 0.78
361 0.82
362 0.84
363 0.82
364 0.79
365 0.73
366 0.64
367 0.54
368 0.45
369 0.34
370 0.27
371 0.2
372 0.13
373 0.1
374 0.09
375 0.08
376 0.08
377 0.1
378 0.12
379 0.16
380 0.21
381 0.3
382 0.4
383 0.49
384 0.58
385 0.6
386 0.63
387 0.69